espin Antibody - BSA Free

Analysis in human testis and skeletal muscle tissues using NBP1-90588 antibody. Corresponding ESPN RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: espin Antibody [NBP1-90588] - Staining of human testis shows moderate membranous positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: espin Antibody [NBP1-90588] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: espin Antibody [NBP1-90588] - Staining of human duodenum shows strong positivity in apical membrane in glandular cells.

Immunohistochemistry-Paraffin: espin Antibody [NBP1-90588] - Staining of human kidney shows strong positivity in luminal membrane in cells in tubules.

Simple Western: espin Antibody [NBP1-90588] - Simple Western lane view shows a specific band for ESPN in 0.2 mg/ml of RT-4 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.

Simple Western: espin Antibody [NBP1-90588] - Electropherogram image(s) of corresponding Simple Western lane view. espin antibody was used at 1:20 dilution on RT-4 lysate(s).

Analysis in human cell line SK-BR-3.

• Reactivity: Hu, Rt
• Applications: WB, Simple Western, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

espin Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit espin Antibody - BSA Free (NBP1-90588) is a polyclonal antibody validated for use in IHC, WB and Simple Western. Anti-espin Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SMPAWRRDLLRKKLEEEREQKRKEEERQKQEELRREKEQSEKLRTLGYDESKLAPWQRQVILKK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ESPN
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Simple Western 1:20
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
  
  In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
  See Simple Western Antibody Database for Simple Western validation: Tested in RT-4, separated by Size, antibody dilution of 1:20, apparent MW was 146 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.
• Control Peptide:

  espin Protein (NBP1-90588PEP)

Reactivity Notes

Rat reactivity reported in (PMID:30467855). Mouse (89%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for espin Antibody - BSA Free

• autosomal recessive deafness type 36 protein
• DKFZp434A196
• DKFZp434G2126
• espin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for espin Antibody (NBP1-90588)(2)

Publications using NBP1-90588

• Masuda H, Nakamuta N, Yamamoto Y. Morphology of GNAT3-immunoreactive chemosensory cells in the rat larynx. J. Anat. 2018-11-23 [PMID: 30467855] (IF/IHC, Rat)
• Hori JI, Koga D, Kakizaki H et al. Differential effects of depot formulations of GnRH agonist leuprorelin and antagonist degarelix on the seminiferous epithelium of the rat testis Biomed. Res. 2018-08-14 [PMID: 30101840] (IHC-P, Rat)

Bioinformatics

• Gene Symbol: ESPN
• Entrez:
  • 83715(Human)
• Uniprot:
  • B1AK53(Human)