PLS1 Antibody (3G10)

Images

 
Western Blot: PLS1 Antibody (3G10) [H00005357-M04] - Analysis of PLS1 expression in Jurkat (Cat # L017V1).
ELISA: PLS1 Antibody (3G10) [H00005357-M04] - Detection limit for recombinant GST tagged PLS1 is approximately 3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, KO
Clone
3G10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PLS1 Antibody (3G10) Summary

Immunogen
PLS1 (NP_002661.1, 1 a.a. - 102 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MENSTTTISREELEELQEAFNKIDIDNSGYVSDYELQDLFKEASLPLPGYKVREIVEKILSVADSNKDGKISFEEFVSLMQELKSKDISKTFRKIINKREGI
Specificity
PLS1 - plastin 1 (I isoform) (3G10)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PLS1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Knockout Validated
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA. Knock Out Validation was reported in scientific literature (PMID: 27811163).
Publications
Read Publication using H00005357-M04.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PLS1 Antibody (3G10)

  • fimbrin
  • I plastin
  • intestine specific plastin
  • Intestine-specific plastin
  • I-plastin
  • plastin 1 (I isoform)
  • plastin 1
  • Plastin-1

Background

Plastins are a family of actin-binding proteins that are conserved throughout eukaryote evolution and expressed in most tissues of higher eukaryotes. In humans, two ubiquitous plastin isoforms (L and T) have been identified. Plastin 1 (otherwise known as Fimbrin) is a third distinct plastin isoform which is specifically expressed at high levels in the small intestine. The L isoform is expressed only in hemopoietic cell lineages, while the T isoform has been found in all other normal cells of solid tissues that have replicative potential (fibroblasts, endothelial cells, epithelial cells, melanocytes, etc.). However, L-plastin has been found in many types of malignant human cells of non-hemopoietic origin suggesting that its expression is induced accompanying tumorigenesis in solid tissues. Fimbrin is a 68-kD actin-bundling protein. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88057
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
AF1034
Species: Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-92190
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16396
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB120-7164
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, IHC-Fr, MiAr
H00007402-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
H00005358-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
H00010097-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-33177
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-1293
Species: Hu, Mu, Rt, Am, Bv, Ca, Ch, Tr
Applications: WB, ICC/IF, IHC, IHC-Fr
NB100-56740
Species: Hu, Mu
Applications: WB, Simple Western, IHC-P
NBP1-58006
Species: Hu
Applications: WB, IHC, IHC-P
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF2275
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NBP2-00527
Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00005357-M04
Species: Hu
Applications: WB, ELISA, KO

Publications for PLS1 Antibody (H00005357-M04)(1)

Reviews for PLS1 Antibody (H00005357-M04) (0)

There are no reviews for PLS1 Antibody (H00005357-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PLS1 Antibody (H00005357-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PLS1 Products

Bioinformatics Tool for PLS1 Antibody (H00005357-M04)

Discover related pathways, diseases and genes to PLS1 Antibody (H00005357-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PLS1 Antibody (H00005357-M04)

Discover more about diseases related to PLS1 Antibody (H00005357-M04).
 

Pathways for PLS1 Antibody (H00005357-M04)

View related products by pathway.

PTMs for PLS1 Antibody (H00005357-M04)

Learn more about PTMs related to PLS1 Antibody (H00005357-M04).

Blogs on PLS1

There are no specific blogs for PLS1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PLS1 Antibody (3G10) and receive a gift card or discount.

Bioinformatics

Gene Symbol PLS1
Entrez
Uniprot