![Immunohistochemistry: USH1C Antibody [NBP1-89189] - Analysis of USH1C on mouse hair cells of the inner ear (tissue fixed with PFA, not embedded, not sectioned) using anti-USH1C antibody. Image submitted by a verified customer review.](http://images.novusbio.com/fullsize2/USH1C Antibody-Immunohistochemistry-NBP1-89189-img0003.jpg "Immunohistochemistry: USH1C Antibody [NBP1-89189] - Analysis of USH1C on mouse hair cells of the inner ear (tissue fixed with PFA, not embedded, not sectioned) using anti-USH1C antibody. Image submitted by a verified customer review.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | IHC, IHC-P |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: IMGKDVRLLRIKKEGSLDLALEGGVDSPIGKVVVSAVYERGAAERHGGIVKGDEIMAINGKIVTDYTLAEAEAALQKAWNQGGDWIDLVVAVCPPKEYDDE |
| Specificity | Specificity of human USH1C antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Predicted Species | Rat (96%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | USH1C |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. USH1C antibody validated for IHC from a verified customer review. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-89189 | Applications | Species |
|---|---|---|
| Pan B, Askew C, Galvin A et al. Gene therapy restores auditory and vestibular function in a mouse model of Usher syndrome type 1c. nature biotechnology. [PMID: 28165476] (IHC, Mouse) | IHC | Mouse |
| Images | Ratings | Applications | Species | Date | Details | ||||
|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Anonymous |
Mouse | 02/08/2017 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Diseases for USH1C Antibody (NBP1-89189)Discover more about diseases related to USH1C Antibody (NBP1-89189).
| Pathways for USH1C Antibody (NBP1-89189)View related products by pathway.
|
Research Areas for USH1C Antibody (NBP1-89189)Find related products by research area.
|
|
Auditory Infographic: Can you hear me now? The auditory process involves several structures of the ear to convert sound waves into information that is processed by our brain. Learn more about the auditory process in our infographic below.Novus Biologicals offers reagents mentioned in the i... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | USH1C |
![Immunohistochemistry-Paraffin: USH1C Antibody [NBP1-89189] - Staining of human colon shows strong cytoplasmic and membranous positivity in glandular cells.](http://images.novusbio.com/fullsize2/USH1C-Antibody-Immunohistochemistry-Paraffin-NBP1-89189-img0002.jpg "Immunohistochemistry-Paraffin: USH1C Antibody [NBP1-89189] - Staining of human colon shows strong cytoplasmic and membranous positivity in glandular cells.")
![Western Blot: Myosin VIIa Antibody [NB120-3481] - Analysis of mouse testes tissue extract.](http://images.novusbio.com/images2/Myosin VIIa Antibody-Western Blot-NB120-3481-img0003.jpg)
![Immunohistochemistry-Paraffin: Cadherin-23 Antibody [NBP3-03833] - Paraffin-embedded rat brain using Cadherin-23 antibody at dilution of 1:100 (40x lens).](http://images.novusbio.com/images2/Cadherin-23-Antibody-Immunohistochemistry-Paraffin-NBP3-03833-img0002.jpg)
![Immunohistochemistry-Paraffin: Cadherin-23 Antibody [NBP3-03833] - Paraffin-embedded mouse brain using Cadherin-23 antibody at dilution of 1:100 (40x lens).](http://images.novusbio.com/images2/Cadherin-23-Antibody-Immunohistochemistry-Paraffin-NBP3-03833-img0001.jpg)
![Immunohistochemistry-Paraffin: Cadherin-23 Antibody [NBP3-03833] - Paraffin-embedded human stomach using Cadherin-23 antibody at dilution of 1:100 (40x lens).](http://images.novusbio.com/images2/Cadherin-23 Antibody-Immunohistochemistry-Paraffin-NBP3-03833-img0003.jpg)
![Immunohistochemistry-Paraffin: USH1G Antibody [NBP1-89076] - Staining of human thyroid gland shows strong cytoplasmic and nuclear positivity in glandular cells.](http://images.novusbio.com/images2/USH1G-Antibody-Immunohistochemistry-Paraffin-NBP1-89076-img0002.jpg)
![Immunohistochemistry-Paraffin: GPR98 Antibody [NLS1729] - Anti-GPR98 / VLGR1 antibody IHC of human Skin, Melanoma. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.](http://images.novusbio.com/images2/GPR98-Antibody-Immunohistochemistry-Paraffin-NLS1729-img0006.jpg)
![Immunohistochemistry-Paraffin: GPR98 Antibody [NLS1729] - Analysis of anti-GPR98 / VLGR1 antibody with human kidney, renal tubules.](http://images.novusbio.com/images2/GPR98-Antibody-Immunohistochemistry-Paraffin-NLS1729-img0002.jpg)
![Immunohistochemistry-Paraffin: GPR98 Antibody [NLS1729] - Analysis of anti-GPR98 / VLGR1 antibody with human brain, cortex.](http://images.novusbio.com/images2/GPR98-Antibody-Immunohistochemistry-Paraffin-NLS1729-img0003.jpg)
![Western Blot: MAGI1 Antibody (7B4) [H00009223-M03] - Analysis of MAGI1 expression in PC-12 (Cat # L012V1).](http://images.novusbio.com/images2/MAGI1 Antibody (7B4)-Western Blot-H00009223-M03-img0006.jpg)
![Immunocytochemistry/Immunofluorescence: MAGI1 Antibody (7B4) [H00009223-M03] - Analysis of monoclonal antibody to MAGI1 on HeLa cell. Antibody concentration 10 ug/ml](http://images.novusbio.com/images2/MAGI1-Antibody-(7B4)-Immunocytochemistry-Immunofluorescence-H00009223-M03-img0005.jpg)
![ELISA: MAGI1 Antibody (7B4) [H00009223-M03] - Detection limit for recombinant GST tagged MAGI1 is approximately 0.3ng/ml as a capture antibody.](http://images.novusbio.com/images2/MAGI1-Antibody-(7B4)-ELISA-H00009223-M03-img0003.jpg)
![Western Blot: Connexin 26/GJB2 Antibody [NBP2-41304] - Western blotting analysis detects Cx26 using R(alpha)Cx26-Ct or R(alpha)Cx26-cl antibodies. (a) R(alpha)Cx26-Ct (A) and R(alpha)Cx26-cl (B) antibodies detected a specific 26kDa band on pig heart tissue lysates (lanes A and B are cropped blots obtained from the same gel). R(alpha)Cx26-cl recognized the 26kDa band on human and rat heart (H) lysates and on rat liver (L) sample (positive control) although two unspecific bands at molecular weights lower than 26kDa were detected. No bands were detected on smooth muscle (SM) tissue lysates (negative control) by R(alpha)Cx26-cl. R(alpha)GAPDH was used as protein loading control for rat tissue samples run on the same gel. Image collected and cropped by CiteAb from the following publication (nature.com/articles/s41598-018-32405-2), licensed under a CC-BY licence.](http://images.novusbio.com/images2/Connexin-26-GJB2-Antibody-Western-Blot-NBP2-41304-img0005.jpg)
![Immunocytochemistry/Immunofluorescence: Connexin 26/GJB2 Antibody [NBP2-41304] - Cx26 distribution at level of the cardiomyocyte cytoplasm. Confocal laser scanning microscopy: representative images of rat and pig heart sections. Double immunofluorescence analysis for Cx26 (red) and Cx43 (green) show a distinct cell localization of the two Cxs. (a) Three dimensional picture of the maximum intensity projection of the raw images of longitudinal rat heart section treated with R(alpha)Cx26-cl and M(alpha)Cx43. Scale bar: 20um. Image collected and cropped by CiteAb from the following publication (nature.com/articles/s41598-018-32405-2), licensed under a CC-BY licence.](http://images.novusbio.com/images2/Connexin-26-GJB2-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-41304-img0002.jpg)
![Immunohistochemistry: Connexin 26/GJB2 Antibody [NBP2-41304] - Human and rat cardiomyocytes immunoreact with R(alpha)Cx26 antibodies. Representative images of immunohistochemical analysis for Cx26 by R(alpha)Cx26-Ct or R(alpha)Cx26-cl antibodies. Longitudinal (c and d) sections showing positivity in cardiomyocytes and in smooth muscle cells of vessel (arrow); Rat (d) immunoperoxidase shows brown immunoreaction in the cell cytoplasm of working cardiomyocytes and in smooth muscle cells of vessels (arrows); positivity of cardiomyocytes and smooth muscle cells has shown, at higher magnification, in longitudinal (d) and cross sections (c); Negative controls are shown in the squares. Scale bars: 50um. Image collected and cropped by CiteAb from the following publication (nature.com/articles/s41598-018-32405-2), licensed under a CC-BY licence.](http://images.novusbio.com/images2/Connexin-26-GJB2-Antibody-Immunohistochemistry-NBP2-41304-img0004.jpg)
![Western Blot: MCC Antibody [NBP1-85885] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/images2/MCC-Antibody-Western-Blot-NBP1-85885-img0007.jpg)
![Immunohistochemistry-Paraffin: MCC Antibody [NBP1-85885] - Staining of human ovary shows moderate cytoplasmic positivity in ovarian stroma cells.](http://images.novusbio.com/images2/MCC-Antibody-Immunohistochemistry-Paraffin-NBP1-85885-img0006.jpg)
![Western Blot: MCC Antibody [NBP1-85885] - Analysis using Anti-MCC antibody NBP1-85885 (A) shows similar pattern to independent antibody NBP2-48671 (B).](http://images.novusbio.com/images2/MCC Antibody-Western Blot-NBP1-85885-img0008.jpg)
![Knockout Validated: Tight Junction Protein 1 Antibody [NBP1-85047] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and TJP1 knockout (KO) HeLa cell line. PVDF membrane was probed with 1:200 of Rabbit Anti-Human TJP1 Polyclonal Antibody (Catalog # NBP1-85047) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog #HAF008). Specific band was detected for TJP1 at approximately 260 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.](http://images.novusbio.com/images2/Tight-Junction-Protein-1-Antibody-Knockout-Validated-NBP1-85047-img0019.jpg)
![Western Blot: Tight Junction Protein 1 Antibody [NBP1-85047] - Analysis in human cell line A-431.](http://images.novusbio.com/images2/Tight-Junction-Protein-1-Antibody-Western-Blot-NBP1-85047-img0021.jpg)
![Immunocytochemistry/Immunofluorescence: Tight Junction Protein 1 Antibody [NBP1-85047] - Rat epithelial cells stained positively with Tight Junction Protein 1. Primary antibody at 1:100. Secondary antibody: goat anti-rabbit-Alexa 488 conjugated at 1:500. ICC/IF image submitted by a verified customer review.](http://images.novusbio.com/images2/Tight-Junction-Protein-1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85047-img0024.jpg)
![Western Blot: PSD-95 Antibody (6G6-1C9) [NB300-556] - Analysis of 25 ug of mouse brain (lane 1) and rat brain (lane 2) cell lysates.](http://images.novusbio.com/images2/PSD-95-Antibody-(6G6-1C9)-Western-Blot-NB300-556-img0020.jpg)
![Immunocytochemistry/Immunofluorescence: PSD-95 Antibody (6G6-1C9) [NB300-556] - Control immunolocalization of plasma membrane AMPA receptor subunits (external epitopes) in hippocampal neuronal cultures. H) Immunolabeling of non-permeabilized neuronal cultures with ani-GluA1 (green). (I) Immunolabeling with the postsynaptic marker anti-PSD95 [66] after permeabilization of neuronal cultures. (J) Merging of (H) and (I) showing postsynaptic labeling of GluA1. Scale bar (valid for all images): 10 um. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0140868), licensed under a CC-BY licence.](http://images.novusbio.com/images2/PSD-95 Antibody (6G6-1C9)-Immunocytochemistry-Immunofluorescence-NB300-556-img0025.jpg)
![Immunohistochemistry-Paraffin: PSD-95 Antibody (6G6-1C9) [NB300-556] - Confocal images of dissociated hippocampal cultures. Double labeling with anti-syntaxin-1 Double labeling with antibodies against syntaxin-1 (D) and synaptophysin (E) indicates that syntaxin-1 is colocalized with presynaptic marker (F). Image collected and cropped by CiteAb from the following publication (http://journal.frontiersin.org/Article/10.3389/fnmol.2016.00010/abstract), licensed under a CC-BY licence.](http://images.novusbio.com/images2/PSD-95-Antibody-(6G6-1C9)-Immunohistochemistry-Paraffin-NB300-556-img0024.jpg)
![Immunohistochemistry-Paraffin: SLC4A7/Sodium bicarbonate cotransporter 3 Antibody [NBP1-87850] - Staining of human duodenum shows moderate to strong membranous positivity in glandular cells.](http://images.novusbio.com/images2/SLC4A7-Sodium-bicarbonate-cotransporter-3-Antibody-Immunohistochemistry-Paraffin-NBP1-87850-img0010.jpg)
![Immunohistochemistry-Paraffin: SLC4A7/Sodium bicarbonate cotransporter 3 Antibody [NBP1-87850] - Analysis in human duodenum and liver tissues. Corresponding SLC4A7 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/images2/SLC4A7-Sodium-bicarbonate-cotransporter-3-Antibody-Immunohistochemistry-Paraffin-NBP1-87850-img0007.jpg)
![Immunohistochemistry-Paraffin: SLC4A7/Sodium bicarbonate cotransporter 3 Antibody [NBP1-87850] - Staining of human tonsil shows moderate to strong membranous positivity in squamous epithelial cells.](http://images.novusbio.com/images2/SLC4A7-Sodium-bicarbonate-cotransporter-3-Antibody-Immunohistochemistry-Paraffin-NBP1-87850-img0008.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.](http://images.novusbio.com/images2/Rabbit-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0006.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.")