![Immunohistochemistry-Paraffin: USH1C Antibody [NBP1-89189] - Analysis in human duodenum and skin tissues using NBP1-89189 antibody. Corresponding USH1C RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/USH1C-Antibody-Immunohistochemistry-Paraffin-NBP1-89189-img0004.jpg "Immunohistochemistry-Paraffin: USH1C Antibody [NBP1-89189] - Analysis in human duodenum and skin tissues using NBP1-89189 antibody. Corresponding USH1C RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: IMGKDVRLLRIKKEGSLDLALEGGVDSPIGKVVVSAVYERGAAERHGGIVKGDEIMAINGKIVTDYTLAEAEAALQKAWNQGGDWIDLVVAVCPPKEYDDE |
| Predicted Species | Rat (96%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | USH1C |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. USH1C antibody validated for IHC from a verified customer review. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-89189 | Applications | Species |
|---|---|---|
| Pan B, Askew C, Galvin A et al. Gene therapy restores auditory and vestibular function in a mouse model of Usher syndrome type 1c. nature biotechnology. [PMID: 28165476] (IF/IHC, Mouse) | IF/IHC | Mouse |
| Images | Ratings | Applications | Species | Date | Details | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
L P |
IHC | Mouse | 02/08/2017 |
Summary
Comments
|
Secondary Antibodies |
Isotype Controls |
Research Areas for USH1C Antibody (NBP1-89189)Find related products by research area.
|
|
Auditory Infographic: Can you hear me now? The auditory process involves several structures of the ear to convert sound waves into information that is processed by our brain. Learn more about the auditory process in our infographic below. Novus Biologicals offers reagents mentioned in the inf... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | USH1C |
![Immunohistochemistry-Paraffin: USH1C Antibody [NBP1-89189] - Staining of human Kidney shows moderate cytoplasmic and membranous positivity in cells in tubules.](http://images.novusbio.com/fullsize/USH1C-Antibody-Immunohistochemistry-Paraffin-NBP1-89189-img0007.jpg "Immunohistochemistry-Paraffin: USH1C Antibody [NBP1-89189] - Staining of human Kidney shows moderate cytoplasmic and membranous positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: USH1C Antibody [NBP1-89189] - Staining of human colon shows strong cytoplasmic and membranous positivity in glandular cells.](http://images.novusbio.com/fullsize/USH1C-Antibody-Immunohistochemistry-Paraffin-NBP1-89189-img0002.jpg "Immunohistochemistry-Paraffin: USH1C Antibody [NBP1-89189] - Staining of human colon shows strong cytoplasmic and membranous positivity in glandular cells.")
![Immunohistochemistry: USH1C Antibody [NBP1-89189] - Analysis of USH1C on mouse hair cells of the inner ear (tissue fixed with PFA, not embedded, not sectioned) using anti-USH1C antibody. Image submitted by a verified customer review.](http://images.novusbio.com/fullsize/USH1C-Antibody-Immunohistochemistry-NBP1-89189-img0003.jpg "Immunohistochemistry: USH1C Antibody [NBP1-89189] - Analysis of USH1C on mouse hair cells of the inner ear (tissue fixed with PFA, not embedded, not sectioned) using anti-USH1C antibody. Image submitted by a verified customer review.")
![Immunohistochemistry-Paraffin: USH1C Antibody [NBP1-89189] - Staining of human Duodenum shows moderate cytoplasmic and membranous positivity in glandular cells.](http://images.novusbio.com/fullsize/USH1C-Antibody-Immunohistochemistry-Paraffin-NBP1-89189-img0005.jpg "Immunohistochemistry-Paraffin: USH1C Antibody [NBP1-89189] - Staining of human Duodenum shows moderate cytoplasmic and membranous positivity in glandular cells.")
![Immunohistochemistry-Paraffin: USH1C Antibody [NBP1-89189] - Staining of human Fallopian tube shows moderate cytoplasmic and membranous positivity in glandular cells.](http://images.novusbio.com/fullsize/USH1C-Antibody-Immunohistochemistry-Paraffin-NBP1-89189-img0006.jpg "Immunohistochemistry-Paraffin: USH1C Antibody [NBP1-89189] - Staining of human Fallopian tube shows moderate cytoplasmic and membranous positivity in glandular cells.")
![Immunohistochemistry-Paraffin: USH1C Antibody [NBP1-89189] - Staining of human Skin shows no positivity in squamous epithelial cells as expected.](http://images.novusbio.com/fullsize/USH1C-Antibody-Immunohistochemistry-Paraffin-NBP1-89189-img0008.jpg "Immunohistochemistry-Paraffin: USH1C Antibody [NBP1-89189] - Staining of human Skin shows no positivity in squamous epithelial cells as expected.")
![Immunocytochemistry Protocadherin-15 Antibody [Unconjugated]](https://images.novusbio.com/images2/Protocadherin-15_AF6729_Immunocytochemistry_10774.jpg)
![Western Blot Protocadherin-15 Antibody [Unconjugated]](https://images.novusbio.com/images2/Protocadherin-15_AF6729_Western_Blot_11962.jpg)
![Immunohistochemistry Protocadherin-15 Antibody [Unconjugated]](https://images.novusbio.com/images2/Protocadherin15_AF6729_Immunohistochemistry_19790.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
