![Immunohistochemistry: USH1C Antibody [NBP1-89189] - Analysis of USH1C on mouse hair cells of the inner ear (tissue fixed with PFA, not embedded, not sectioned) using anti-USH1C antibody. This image was submitted via customer Review.](http://images.novusbio.com/fullsize2/USH1C Antibody-Immunohistochemistry-NBP1-89189-img0003.jpg "Immunohistochemistry: USH1C Antibody [NBP1-89189] - Analysis of USH1C on mouse hair cells of the inner ear (tissue fixed with PFA, not embedded, not sectioned) using anti-USH1C antibody. This image was submitted via customer Review.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | IHC, IHC-P |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: IMGKDVRLLRIKKEGSLDLALEGGVDSPIGKVVVSAVYERGAAERHGGIVKGDEIMAINGKIVTDYTLAEAEAALQKAWNQGGDWIDLVVAVCPPKEYDDE |
| Specificity | Specificity of human, mouse USH1C antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Predicted Species | Rat (96%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | USH1C |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-89189 | Applications | Species |
|---|---|---|
| Pan B, Askew C, Galvin A et al. Gene therapy restores auditory and vestibular function in a mouse model of Usher syndrome type 1c. nature biotechnology. [PMID: 28165476] (IHC, Mouse) | IHC | Mouse |
| Images | Ratings | Applications | Species | Date | Details | ||||
|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Anonymous |
Mouse | 02/08/2017 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Diseases for USH1C Antibody (NBP1-89189)Discover more about diseases related to USH1C Antibody (NBP1-89189).
| Pathways for USH1C Antibody (NBP1-89189)View related products by pathway.
|
Research Areas for USH1C Antibody (NBP1-89189)Find related products by research area.
|
|
Auditory Infographic: Can you hear me now? The auditory process involves several structures of the ear to convert sound waves into information that is processed by our brain. Learn more about the auditory process in our infographic below.Novus Biologicals offers reagents mentioned in the i... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | USH1C |
![Immunohistochemistry-Paraffin: USH1C Antibody [NBP1-89189] - Staining of human colon shows strong cytoplasmic and membranous positivity in glandular cells.](http://images.novusbio.com/fullsize2/USH1C-Antibody-Immunohistochemistry-Paraffin-NBP1-89189-img0002.jpg "Immunohistochemistry-Paraffin: USH1C Antibody [NBP1-89189] - Staining of human colon shows strong cytoplasmic and membranous positivity in glandular cells.")
![Immunocytochemistry/Immunofluorescence: Myosin VIIa Antibody [NBP1-84266] - Staining of human cell line U-2 OS shows positivity in cytoplasm. Antibody staining is shown in green.](http://images.novusbio.com/fullsize2/Myosin-VIIa-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-84266-img0004.jpg)
![Immunohistochemistry-Paraffin: Myosin VIIa Antibody [NBP1-84266] - Staining of human adrenal gland shows strong cytoplasmic and membranous positivity in cortical cells.](http://images.novusbio.com/fullsize2/Myosin-VIIa-Antibody-Immunohistochemistry-Paraffin-NBP1-84266-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: Cadherin-23 Antibody [NBP1-85704] - CDH23 Antibody [NBP1-85704] - Staining of human cell line A-431 shows positivity in nucleoli. Antibody staining is shown in green.](http://images.novusbio.com/fullsize2/CDH23 Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85704-img0003.jpg)
![Immunohistochemistry-Paraffin: CDH23 Antibody [NBP1-85704] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/CDH23 Antibody-Immunohistochemistry-Paraffin-NBP1-85704-img0002.jpg)
![Western Blot: USH1G Antibody [NBP2-20823] - Sample (30 ug of whole cell lysate) A: A431 10% SDS PAGE gel, diluted at 1:1000.](http://images.novusbio.com/fullsize2/USH1G Antibody-Western Blot-NBP2-20823-img0001.jpg)
![Immunohistochemistry-Paraffin: USH1G Antibody [NBP2-20823] - Immunohistochemical analysis of paraffin-embedded gastric ca, using antibody at 1:500 dilution.](http://images.novusbio.com/fullsize2/USH1G Antibody-Immunohistochemistry-Paraffin-NBP2-20823-img0002.jpg)
![Immunohistochemistry-Paraffin: GPR98 Antibody [NLS1729] - Anti-GPR98 / VLGR1 antibody IHC of human Skin, Melanoma. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.](http://images.novusbio.com/fullsize2/GPR98-Antibody-Immunohistochemistry-Paraffin-NLS1729-img0006.jpg)
![Immunohistochemistry-Paraffin: GPR98 Antibody [NLS1729] - Analysis of anti-GPR98 / VLGR1 antibody with human kidney, renal tubules.](http://images.novusbio.com/fullsize2/GPR98-Antibody-Immunohistochemistry-Paraffin-NLS1729-img0002.jpg)
![Immunohistochemistry-Paraffin: GPR98 Antibody [NLS1729] - Analysis of anti-GPR98 / VLGR1 antibody with human brain, cortex.](http://images.novusbio.com/fullsize2/GPR98-Antibody-Immunohistochemistry-Paraffin-NLS1729-img0003.jpg)
![Immunocytochemistry/Immunofluorescence: DFNB31 Antibody (2D12) [H00025861-M05] - Analysis of monoclonal antibody to DFNB31 on HeLa cell. Antibody concentration 10 ug/ml](http://images.novusbio.com/fullsize2/DFNB31-Antibody-(2D12)-Immunocytochemistry-Immunofluorescence-H00025861-M05-img0001.jpg)
![Western Blot: MAGI1 Antibody (7B4) [H00009223-M03] - Analysis of MAGI1 expression in PC-12 (Cat # L012V1).](http://images.novusbio.com/fullsize2/MAGI1 Antibody (7B4)-Western Blot-H00009223-M03-img0006.jpg)
![Immunocytochemistry/Immunofluorescence: MAGI1 Antibody (7B4) [H00009223-M03] - Analysis of monoclonal antibody to MAGI1 on HeLa cell. Antibody concentration 10 ug/ml](http://images.novusbio.com/fullsize2/MAGI1-Antibody-(7B4)-Immunocytochemistry-Immunofluorescence-H00009223-M03-img0005.jpg)
![ELISA: MAGI1 Antibody (7B4) [H00009223-M03] - Detection limit for recombinant GST tagged MAGI1 is approximately 0.3ng/ml as a capture antibody.](http://images.novusbio.com/fullsize2/MAGI1-Antibody-(7B4)-ELISA-H00009223-M03-img0003.jpg)
![Western Blot: MCC Antibody [NBP1-85885] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize2/MCC-Antibody-Western-Blot-NBP1-85885-img0007.jpg)
![Immunohistochemistry-Paraffin: MCC Antibody [NBP1-85885] - Staining of human ovary shows moderate cytoplasmic positivity in ovarian stroma cells.](http://images.novusbio.com/fullsize2/MCC-Antibody-Immunohistochemistry-Paraffin-NBP1-85885-img0006.jpg)
![Western Blot: MCC Antibody [NBP1-85885] - Analysis using Anti-MCC antibody NBP1-85885 (A) shows similar pattern to independent antibody NBP2-48671 (B).](http://images.novusbio.com/fullsize2/MCC Antibody-Western Blot-NBP1-85885-img0008.jpg)
![Knockout Validated: Tight Junction Protein 1 Antibody [NBP1-85047] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and TJP1 knockout (KO) HeLa cell line. PVDF membrane was probed with 1:200 of Rabbit Anti-Human TJP1 Polyclonal Antibody (Catalog # NBP1-85047) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog #HAF008). Specific band was detected for TJP1 at approximately 260 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.](http://images.novusbio.com/fullsize2/Tight-Junction-Protein-1-Antibody-Knockout-Validated-NBP1-85047-img0019.jpg)
![Western Blot: Tight Junction Protein 1 Antibody [NBP1-85047] - Analysis in human cell line A-431.](http://images.novusbio.com/fullsize2/Tight-Junction-Protein-1-Antibody-Western-Blot-NBP1-85047-img0021.jpg)
![Immunocytochemistry/Immunofluorescence: Tight Junction Protein 1 Antibody [NBP1-85047] - Staining of human cell line U-2 OS shows localization to cytosol & cell junctions. Antibody staining is shown in green.](http://images.novusbio.com/fullsize2/Tight-Junction-Protein-1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85047-img0008.jpg)
![Western Blot: PSD-95 Antibody (6G6-1C9) [NB300-556] - Analysis of 25 ug of mouse brain (lane 1) and rat brain (lane 2) cell lysates.](http://images.novusbio.com/fullsize2/PSD-95-Antibody-(6G6-1C9)-Western-Blot-NB300-556-img0020.jpg)
![Immunocytochemistry: PSD-95 Antibody (6G6-1C9) [NB300-556] - Mixed 3 week old rat cortical cultures (21 DIV) were labelled with anti-PSD95 (1:650) and visualised with anti-mouse Alexa647 (1:2000). The antibody labels small punctae along neuronal processes as expected. This image was submitted via customer Review.](http://images.novusbio.com/fullsize2/PSD-95-Antibody-(6G6-1C9)-Immunocytochemistry-NB300-556-img0021.jpg)
![Flow Cytometry: PSD-95 Antibody (6G6-1C9) [NB300-556] - An intracellular stain was performed on HeLa cells with PSD-95 Antibody (6G6-1C9) NB300-556AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.](http://images.novusbio.com/fullsize2/PSD-95-Antibody-(6G6-1C9)-Flow-Cytometry-NB300-556-img0023.jpg)
![Immunohistochemistry-Paraffin: SLC4A7/Sodium bicarbonate cotransporter 3 Antibody [NBP1-87850] - Staining of human duodenum shows moderate to strong membranous positivity in glandular cells.](http://images.novusbio.com/fullsize2/SLC4A7-Sodium-bicarbonate-cotransporter-3-Antibody-Immunohistochemistry-Paraffin-NBP1-87850-img0010.jpg)
![Immunohistochemistry-Paraffin: SLC4A7/Sodium bicarbonate cotransporter 3 Antibody [NBP1-87850] - Analysis in human duodenum and liver tissues. Corresponding SLC4A7 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize2/SLC4A7-Sodium-bicarbonate-cotransporter-3-Antibody-Immunohistochemistry-Paraffin-NBP1-87850-img0007.jpg)
![Immunohistochemistry-Paraffin: SLC4A7/Sodium bicarbonate cotransporter 3 Antibody [NBP1-87850] - Staining of human tonsil shows moderate to strong membranous positivity in squamous epithelial cells.](http://images.novusbio.com/fullsize2/SLC4A7-Sodium-bicarbonate-cotransporter-3-Antibody-Immunohistochemistry-Paraffin-NBP1-87850-img0008.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.](http://images.novusbio.com/images2/Rabbit-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0006.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.")