USH1C Antibody

Images

 
Immunohistochemistry-Paraffin: USH1C Antibody [NBP1-89189] - Staining of human colon shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

USH1C Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:IMGKDVRLLRIKKEGSLDLALEGGVDSPIGKVVVSAVYERGAAERHGGIVKGDEIMAINGKIVTDYTLAEAEAALQKAWNQGGDWIDLVVAVCPPKEYDDE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
USH1C
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
USH1C Recombinant Protein Antigen (NBP1-89189PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-89189 in the following applications:

Publications
Read Publication using
NBP1-89189 in the following applications:

  • IHC
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for USH1C Antibody

  • AIE75
  • AIE-75
  • Antigen NY-CO-38/NY-CO-37
  • Autoimmune enteropathy-related antigen AIE-75
  • deafness, autosomal recessive 18
  • DFNB18
  • harmonin
  • NY-CO-37
  • NY-CO-38
  • PDZ-45
  • PDZ73
  • PDZ-73
  • PDZ-73/NY-CO-38
  • Protein PDZ-73
  • Renal carcinoma antigen NY-REN-3
  • ush1cpst
  • Usher syndrome 1C (autosomal recessive, severe)
  • Usher syndrome type-1C protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84266
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-85704
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF6729
Species: Hu
Applications: WB, IHC, ICC
NBP1-89076
Species: Hu
Applications: IHC, IHC-P
42720002
Species: Ze
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr
NLS1729
Species: Hu, Eq
Applications: WB, IHC-P
H00025861-M05
Species: Hu
Applications: WB, ELISA, ICC/IF
H00009223-M03
Species: Hu, Rt, Ca, Ha
Applications: WB, ELISA, ICC/IF
NBP1-85885
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00079955-P01
Species: Hu
NBP1-85047
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P, ICC
NB300-556
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP

Publications for USH1C Antibody (NBP1-89189)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Review for USH1C Antibody (NBP1-89189) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using NBP1-89189:
Filter by Applications
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
 USH1C NBP1-89189
Enlarge
reviewed by:
Anonymous
Mouse 02/08/2017
View

Summary

Sample TestedHair cells of the inner ear
SpeciesMouse

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for USH1C Antibody (NBP1-89189) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional USH1C Products

Bioinformatics Tool for USH1C Antibody (NBP1-89189)

Discover related pathways, diseases and genes to USH1C Antibody (NBP1-89189). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for USH1C Antibody (NBP1-89189)

Discover more about diseases related to USH1C Antibody (NBP1-89189).
 

Pathways for USH1C Antibody (NBP1-89189)

View related products by pathway.

Research Areas for USH1C Antibody (NBP1-89189)

Find related products by research area.

Blogs on USH1C.

Auditory Infographic: Can you hear me now?
The auditory process involves several structures of the ear to convert sound waves into information that is processed by our brain. Learn more about the auditory process in our infographic below.Novus Biologicals offers reagents mentioned in the i...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Anonymous
02/08/2017
Application:
Species: Mouse

Bioinformatics

Gene Symbol USH1C