Reactivity | Hu, Mu, RtSpecies Glossary |
Applications | IHC, IHC-P |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: IMGKDVRLLRIKKEGSLDLALEGGVDSPIGKVVVSAVYERGAAERHGGIVKGDEIMAINGKIVTDYTLAEAEAALQKAWNQGGDWIDLVVAVCPPKEYDDE |
Specificity | Specificity of human USH1C antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Predicted Species | Rat (96%). Backed by our 100% Guarantee. |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | USH1C |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. USH1C antibody validated for IHC from a verified customer review. |
||
Control Peptide |
|
||
Reviewed Applications |
|
||
Publications |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Immunogen affinity purified |
Publication using NBP1-89189 | Applications | Species |
---|---|---|
Pan B, Askew C, Galvin A et al. Gene therapy restores auditory and vestibular function in a mouse model of Usher syndrome type 1c. nature biotechnology. [PMID: 28165476] (IHC, Mouse) | IHC | Mouse |
Images | Ratings | Applications | Species | Date | Details | ||||
---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Anonymous |
Mouse | 02/08/2017 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Diseases for USH1C Antibody (NBP1-89189)Discover more about diseases related to USH1C Antibody (NBP1-89189).
| Pathways for USH1C Antibody (NBP1-89189)View related products by pathway.
|
Research Areas for USH1C Antibody (NBP1-89189)Find related products by research area.
|
Auditory Infographic: Can you hear me now? The auditory process involves several structures of the ear to convert sound waves into information that is processed by our brain. Learn more about the auditory process in our infographic below.Novus Biologicals offers reagents mentioned in the i... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | USH1C |