Erythropoietin R Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit Erythropoietin R Antibody - BSA Free (NBP3-21413) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: SCSSALASKPSPEGASAASFEYTILDPSSQLLRPWTLCPELPPTPPHLKYLYLVVSDSGISTDYSSGDSQGAQGGLSDGPYSNPYENSLIPAAEPLPPSYVACS |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
EPOR |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
| Application Notes |
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Erythropoietin R Antibody - BSA Free
Background
The human erythropoietin receptor (EpoR) is located on stem and mature cells of the hematopoietic system. When activated by its native ligand, erythropoietin (Epo), EpoR mediates proliferation and maturation of the erythroid precursor cells leading to expansion of red cell populations. Human recombinant Epo is currently used for treatment of patients undergoing erythrocyte depletion due to dialysis for kidney failure.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ELISA, Flow, ICC/IF, MiAr, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: ChIP, Simple Western, WB
Species: Hu, Mu
Applications: CyTOF-ready, ICC, IP, ICFlow, KO, Simple Western, WB
Species: Pm, Hu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: Neut, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Rt
Applications: IHC, WB
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: IP, Simple Western, WB
Species: Hu
Applications: ICC/IF
Publications for Erythropoietin R Antibody (NBP3-21413) (0)
There are no publications for Erythropoietin R Antibody (NBP3-21413).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Erythropoietin R Antibody (NBP3-21413) (0)
There are no reviews for Erythropoietin R Antibody (NBP3-21413).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Erythropoietin R Antibody (NBP3-21413) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Erythropoietin R Products
Research Areas for Erythropoietin R Antibody (NBP3-21413)
Find related products by research area.
|
Blogs on Erythropoietin R