![Immunohistochemistry-Paraffin: ERV3-1 Antibody [NBP2-62602] - Analysis in human adrenal gland and liver tissues. Corresponding ERV3-1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/ERV3-1-Antibody-Immunohistochemistry-Paraffin-NBP2-62602-img0006.jpg "Immunohistochemistry-Paraffin: ERV3-1 Antibody [NBP2-62602] - Analysis in human adrenal gland and liver tissues. Corresponding ERV3-1 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit ERV3-1 Antibody - BSA Free (NBP2-62602) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: QLAENIASSLHVASCYVCGGMNMGDQWPWEARELMPQDNFTLTASSLEPAPSSQSIWFLKTSIIGKFCIARWGKAFTDPVGELTCLGQQYYNETLGKTLWRGKSNNSESPHPSPFSRFPSLNHSWYQLEA |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ERV3-1 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ERV3-1 |
![Western Blot: ERV3-1 Antibody [NBP2-62602] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.](http://images.novusbio.com/fullsize/ERV3-1-Antibody-Western-Blot-NBP2-62602-img0005.jpg "Western Blot: ERV3-1 Antibody [NBP2-62602] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.")
![Immunohistochemistry-Paraffin: ERV3-1 Antibody [NBP2-62602] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/ERV3-1-Antibody-Immunohistochemistry-Paraffin-NBP2-62602-img0010.jpg "Immunohistochemistry-Paraffin: ERV3-1 Antibody [NBP2-62602] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: ERV3-1 Antibody [NBP2-62602] - Staining of human adrenal gland shows moderate to strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/ERV3-1-Antibody-Immunohistochemistry-Paraffin-NBP2-62602-img0007.jpg "Immunohistochemistry-Paraffin: ERV3-1 Antibody [NBP2-62602] - Staining of human adrenal gland shows moderate to strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: ERV3-1 Antibody [NBP2-62602] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/ERV3-1-Antibody-Immunohistochemistry-Paraffin-NBP2-62602-img0008.jpg "Immunohistochemistry-Paraffin: ERV3-1 Antibody [NBP2-62602] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.")
![Immunohistochemistry-Paraffin: ERV3-1 Antibody [NBP2-62602] - Staining of human epididymis shows moderate to strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/ERV3-1-Antibody-Immunohistochemistry-Paraffin-NBP2-62602-img0009.jpg "Immunohistochemistry-Paraffin: ERV3-1 Antibody [NBP2-62602] - Staining of human epididymis shows moderate to strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: ERV3-1 Antibody [NBP2-62602] - Staining of human liver shows very weak cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize/ERV3-1-Antibody-Immunohistochemistry-Paraffin-NBP2-62602-img0011.jpg "Immunohistochemistry-Paraffin: ERV3-1 Antibody [NBP2-62602] - Staining of human liver shows very weak cytoplasmic positivity in hepatocytes.")
![SDS-PAGE IL-1 beta/IL-1F2 [Unconjugated]](https://images.novusbio.com/images2/IL-1_beta_201-LB_304.jpg)
![Bioactivity IL-1 beta/IL-1F2 [Unconjugated]](https://images.novusbio.com/images2/IL-1_beta_201-LB_306.jpg)
![SEC-MALS IL-1 beta/IL-1F2 [Unconjugated]](https://images.novusbio.com/images/201-lb_recombinant-human-il-1-beta-il-1f2-protein-sec-mals-123202491556.jpg)
![Bioactivity IFN-gamma [Unconjugated]](https://images.novusbio.com/images2/IFNgamma_285IF_2848.jpg)
![SDS-PAGE IFN-gamma [Unconjugated]](https://images.novusbio.com/images2/IFN-gamma_285-IF_230.jpg)
![SEC-MALS IFN-gamma [Unconjugated]](https://images.novusbio.com/images/285-if_recombinant-human-ifn-gamma-protein-sec-mals-1520239228..jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/DATA_IL6_M6000_ELISA_936.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/IL-6_M6000_ELISA_415.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images/m6000b_mouse-il-6-quantikine-elisa-kit-44202415433118.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Flow Cytometry CMG-2/ANTXR2 Antibody [Unconjugated]](https://images.novusbio.com/images2/CMG-2_AF2940_Flow_Cytometry_8191.jpg)
![Western Blot CMG-2/ANTXR2 Antibody [Unconjugated]](https://images.novusbio.com/images/af2940_human-cmg-2-affinity-purified-polyclonal-ab-4120241240225.jpg)
![Western Blot CMG-2/ANTXR2 Antibody [Unconjugated]](https://images.novusbio.com/images/af2940_human-cmg-2-affinity-purified-polyclonal-ab-41202412394949.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")