ERp72 Antibody

Images

 
Western Blot: ERp72 Antibody [NBP1-84794] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: ERp72 Antibody [NBP1-84794] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Western Blot: ERp72 Antibody [NBP1-84794] - Lane 1: Marker [kDa] 229, 112, 84, 48, 32, 27, 17. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ERp72 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:AKRFDVSGYPTLKIFRKGRPYDYNGPREKYGIVDYMIEQSGPPSKEILTLKQVQEFLKDGDDVIIIGVFKGESDPAYQQYQDAANNLREDYKFHHTFSTEIAKFLKVSQGQLVVMQPEKFQSKYEPRS
Marker
Endoplasmic Reticulum Marker
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PDIA4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ERp72 Protein (NBP1-84794PEP)
Publications
Read Publication using NBP1-84794.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%), Rat (89%). Reactivity reported in scientific literature (PMID: 21743296)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ERp72 Antibody

  • Endoplasmic reticulum resident protein 70
  • Endoplasmic reticulum resident protein 72
  • ER protein 70
  • ERp70
  • ERP70ER protein 72
  • ERp72
  • ERp-72
  • ERP72EC 5.3.4.1
  • intestinal-related)
  • protein disulfide isomerase family A, member 4
  • protein disulfide isomerase related protein (calcium-binding protein
  • protein disulfide isomerase-associated 4
  • protein disulfide-isomerase A4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
NBP1-84796
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89394
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00005034-B01P
Species: Hu
Applications: WB, ICC/IF
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
NB300-517
Species: Hu, Mu, Rt, Po, Bv, Ha, Pm, Rb
Applications: WB, B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IM, IP
NB300-619
Species: Hu, Mu, Rt, Bv, Ch, Ha
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-37761
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF1543
Species: Hu
Applications: WB, IHC
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NB100-1965
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Dr, GP, Rb, Sh, Xp, Ze
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-57999
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IP
NBP1-71702
Species: Hu, Mu, Ch
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-85965
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-1335
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-14113
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-33076
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84794
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for ERp72 Antibody (NBP1-84794)(1)

Reviews for ERp72 Antibody (NBP1-84794) (0)

There are no reviews for ERp72 Antibody (NBP1-84794). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ERp72 Antibody (NBP1-84794) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ERp72 Products

Bioinformatics Tool for ERp72 Antibody (NBP1-84794)

Discover related pathways, diseases and genes to ERp72 Antibody (NBP1-84794). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ERp72 Antibody (NBP1-84794)

Discover more about diseases related to ERp72 Antibody (NBP1-84794).
 

Pathways for ERp72 Antibody (NBP1-84794)

View related products by pathway.

PTMs for ERp72 Antibody (NBP1-84794)

Learn more about PTMs related to ERp72 Antibody (NBP1-84794).
 

Research Areas for ERp72 Antibody (NBP1-84794)

Find related products by research area.

Blogs on ERp72

There are no specific blogs for ERp72, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ERp72 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PDIA4