Erbin Antibody

Western Blot: Erbin Antibody [NBP2-56104] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

Immunocytochemistry/Immunofluorescence: Erbin Antibody [NBP2-56104] - Staining of human cell line U-251 MG shows localization to nuclear speckles, plasma membrane & cell junctions. Antibody staining is shown in green.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, KD
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Erbin Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SENLKHIVNHDDVFEESEELSSDEEMKMAEMRPPLIETSINQPKVVALSNNKKDDTKETDSLSDEVTHNSNQNNSNCSSPS
• Predicted Species: Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ERBB2IP
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Erbin Recombinant Protein Antigen (NBP2-56104PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Erbin Antibody

• Densin-180-like protein
• erbb2 interacting protein
• Erbb2-interacting proteinErbin
• ERBB2IP
• Erbin
• ERBINLAP2protein LAP2
• KIAA1225

Background

The ERBB2IP gene encodes a LAP2 protein that exists in nine isoforms: Isoform 1: 1,412 amino acids long, 158 kDA; isoform 2: 1,371 amino acids long, 153 kDA; isoform 3: 1,360 amino acids long, 152 kDA; isoform 4: 1,346 amino acids, 151 kDA; isoform 5: 1,356 amino acids long, 152 kDA; isoform 6: 1,340 amino acids long, 150 kDA; isoform 7: 1,302 amino acids long, 146 kDA; isoform 8: 1,419 amino acids long, 159 kDA; isoform 9 is 1,367 amino acids long at 153 kDA. ERBB2IP functions as an adapter for the receptor ERBB2, and through binding of this receptor, it contributes to the stabilization of this unphosphorylated state. ERBB2IP participates in the NOD pathway, TGF-beta receptor signaling pathway, signal transduction, and with NLR proteins. It is known to interact with genes PKP4, SMAD3, ERBB2, ZFYVE9, and CTNNB1. ERBB2IP is associated with breast cancer, carcinoma, cervical cancer, crohn's disease, and epidermolysis bullosa.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ERBB2IP