LAP1B Antibody - BSA Free

Immunohistochemistry-Paraffin: LAP1B Antibody [NBP2-47403] - Staining of human cerebral cortex, kidney, lymph node and testis using Anti-TOR1AIP1 antibody NBP2-47403 (A) shows similar protein distribution across tissues to independent antibody NBP2-47402 (B).

Western Blot: LAP1B Antibody [NBP2-47403] - Analysis using Anti-TOR1AIP1 antibody NBP2-47403 (A) shows similar pattern to independent antibody NBP2-47402 (B).

Immunocytochemistry/Immunofluorescence: LAP1B Antibody [NBP2-47403] - Staining of human cell line MCF7 shows localization to nuclear membrane. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: LAP1B Antibody [NBP2-47403] - Staining of human cerebral cortex.

Immunohistochemistry-Paraffin: LAP1B Antibody [NBP2-47403] - Staining of human kidney shows strong positivity in nuclear membrane in cells in tubules.

Immunohistochemistry-Paraffin: LAP1B Antibody [NBP2-47403] - Staining of human cervix, uterine shows strong positivity in nuclear membrane in glandular cells.

Immunohistochemistry-Paraffin: LAP1B Antibody [NBP2-47403] - Staining of human thyroid gland shows strong positivity in nuclear membrane in glandular cells.

Immunohistochemistry-Paraffin: LAP1B Antibody [NBP2-47403] - Staining of human testis.

Immunohistochemistry-Paraffin: LAP1B Antibody [NBP2-47403] - Staining of human lymph node.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

LAP1B Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: EATSVQQKVNFSEEGETEEDDQDSSHSSVTTVKARSRDSDESGDKTTRSSSQYIESFWQSSQSQNFTAHDKQRSVLSSGYQKTPQEWAPQTARIRTRMQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TOR1AIP1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  LAP1B Protein (NBP2-47403PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for LAP1B Antibody - BSA Free

• DKFZp586G011
• FLJ13142
• lamina associated polypeptide 1B
• lamina-associated polypeptide 1B
• LAP1B
• MGC3413
• torsin A interacting protein 1
• torsin-1A-interacting protein 1

Background

Lamina-associated polypeptide 1B (LAPB1) binds to A- and B-type lamins. It is a single-pass membrane protein that localizes to the inner membrane of the nucleus and may play a role in membrane attachment and the assembly of the nuclear lamina. LAPB1 is also called torsin-1A-interacting protein 1 (TOR1AIP1) due to its association with torsin, an ATPase of the AAA- (adenosine triphosphatases associated with diverse cellular activities) family of proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TOR1AIP1