ErbB4/Her4 Antibody - BSA Free

Analysis in human testis and liver tissues using Anti-ERBB4 antibody. Corresponding ERBB4 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: ErbB4/Her4 Antibody [NBP1-90371] - Staining of human testis shows high expression.

Immunohistochemistry-Paraffin: ErbB4/Her4 Antibody [NBP1-90371] - Staining of human liver shows low expression as expected.

• Reactivity: Hu, Mu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ErbB4/Her4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ErbB4/Her4 Antibody - BSA Free (NBP1-90371) is a polyclonal antibody validated for use in IHC. Anti-ErbB4/Her4 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LPSPNDSKFFQNLLDEEDLEDMMDAEEYLVPQAFNIPPPIYTSRARIDSNRNQFVYRDGGFAAEQGVSVPYRAPTSTIPEAPVAQGATAEIFDDSCCNGTLRK
• Predicted Species: Mouse (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ERBB4
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  ErbB4/Her4 Recombinant Protein Antigen (NBP1-90371PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ErbB4/Her4 Antibody - BSA Free

• avian erythroblastic leukemia viral (v-erb-b2) oncogene homolog 4
• EC 2.7.10
• EC 2.7.10.1
• ErbB4
• HER4
• HER4MGC138404
• p180erbB4
• Proto-oncogene-like protein c-ErbB-4
• receptor tyrosine-protein kinase erbB-4
• Tyrosine kinase-type cell surface receptor HER4
• v-erb-a avian erythroblastic leukemia viral oncogene homolog-like 4
• v-erb-a erythroblastic leukemia viral oncogene homolog 4 (avian)

Background

erbB4/HER4 is a receptor tyrosine kinase that belongs to the human epidermal growth factor receptor (EGFR) family. erbB4/HER4 is most predominantly expressed in several breast carcinoma cell lines, and in normal skeletal muscle, heart, pituitary, brain, and cerebellum (1). erbB4/HER4 is activated by neuregulins (NRG), betacellulin (BTC), and heparin-binding EGF-like growth factor (2). Neuregulins regulate the expression of ligand- and voltage-gated channels in neurons and skeletal muscle by the activation of ErbB 1-4. The erbB4/HER4 receptor is unique among these receptors because its C-terminal tail binds to a protein motif known as the PDZ domain (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ErbB4/Her4 Antibody (NBP1-90371)(1)

Publication using NBP1-90371

• Baiocchi G, de Freitas RR, Bovolim G et al. Immunohistochemical expression of ErbB/HER family proteins in patients with vulvar cancer International journal of gynaecology and obstetrics: the official organ of the International Federation of Gynaecology and Obstetrics 2021-07-16 [PMID: 34270807]

Bioinformatics

• Gene Symbol: ERBB4
• Entrez:
  • 2066(Human)
• Uniprot:
  • Q15303()