Eps8 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Eps8 Antibody [NBP1-86150] - Immunofluorescent staining of human cell line U-251 MG shows localization to the Golgi apparatus.

Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.

Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.

Staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells.

Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Eps8 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Eps8 Antibody - BSA Free (NBP1-86150) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PKEQFIPPYVPRFRNGWEPPMLNFMGATMEQDLYQLAESVANVAEHQRKQEIKRLSTEHSSVSEYHPADGYAFSSNIYTRGSHLDQGEAAVAFKPTSNRHIDRNYEPLKTQPKKYAKSKYDFVARNNSELSVLKDDILEILDD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EPS8
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Eps8 Protein (NBP1-86150PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (80%), Rat (80%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Eps8 Antibody - BSA Free

• epidermal growth factor receptor kinase substrate 8
• epidermal growth factor receptor pathway substrate 8
• Eps8

Background

EPS8 encodes a member of the EPS8 family. This protein contains one PH domain and one SH3 domain. It functions as part of the EGFR pathway, though its exact role has not been determined. Highly similar proteins in other organisms are involved in the transduction of signals from Ras to Rac and growth factor-mediated actin remodeling. Alternate transcriptional splice variants of this gene have been observed but have not been thoroughly characterized.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: EPS8