Eps8 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Eps8 Antibody [NBP1-86150] - Immunofluorescent staining of human cell line U-251 MG shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: Eps8 Antibody [NBP1-86150] - Staining of human pancreas shows cytoplasmic positivity in exocrine glandular cells and islet cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Eps8 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PKEQFIPPYVPRFRNGWEPPMLNFMGATMEQDLYQLAESVANVAEHQRKQEIKRLSTEHSSVSEYHPADGYAFSSNIYTRGSHLDQGEAAVAFKPTSNRHIDRNYEPLKTQPKKYAKSKYDFVARNNSELSVLKDDILEILDD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EPS8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Eps8 Protein (NBP1-86150PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (80%), Rat (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Eps8 Antibody

  • epidermal growth factor receptor kinase substrate 8
  • epidermal growth factor receptor pathway substrate 8
  • Eps8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-59845
Species: Hu
Applications: IP (-), WB, IHC-P
NBP1-52556
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-00810
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00006464-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, PLA
NBP1-83061
Species: Hu
Applications: WB, IHC, IHC-P
AF6260
Species: Hu
Applications: WB
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00010096-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00056731-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-45923
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB120-13253
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC

Publications for Eps8 Antibody (NBP1-86150) (0)

There are no publications for Eps8 Antibody (NBP1-86150).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Eps8 Antibody (NBP1-86150) (0)

There are no reviews for Eps8 Antibody (NBP1-86150). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Eps8 Antibody (NBP1-86150) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Eps8 Products

Bioinformatics Tool for Eps8 Antibody (NBP1-86150)

Discover related pathways, diseases and genes to Eps8 Antibody (NBP1-86150). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Eps8 Antibody (NBP1-86150)

Discover more about diseases related to Eps8 Antibody (NBP1-86150).
 

Pathways for Eps8 Antibody (NBP1-86150)

View related products by pathway.

PTMs for Eps8 Antibody (NBP1-86150)

Learn more about PTMs related to Eps8 Antibody (NBP1-86150).

Blogs on Eps8.

Hsc70 - a chaperone protein with diverse cellular functions
Heat shock cognate 71 kDa protein (Hsc70), also known as HSPA8, is a member of the heat shock protein 70 family (Hsp70). Unlike Hsp70, it is a constitutively expressed chaperone protein and is involved in diverse cellular processes including protei...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Eps8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EPS8
Entrez