![Immunohistochemistry-Paraffin: EphA10 Antibody [NBP1-83677] - Staining of human testis shows strong cytoplasmic positivity in Leydig cells.](http://images.novusbio.com/fullsize/EphA10-Antibody-Immunohistochemistry-Paraffin-NBP1-83677-img0001.jpg "Immunohistochemistry-Paraffin: EphA10 Antibody [NBP1-83677] - Staining of human testis shows strong cytoplasmic positivity in Leydig cells.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | Simple Western, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit EphA10 Antibody - BSA Free (NBP1-83677) is a polyclonal antibody validated for use in IHC and Simple Western. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TTYAQVTVSTGPGAPWEEDEIRRDRVEPQSVSLSWREPIPAGAPGANDTEYEIRYYEKGQSEQTYSMVKTGAPTVTVTNLKPATRYVFQIRAAS |
| Predicted Species | Mouse (94%), Rat (93%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | EPHA10 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Simple Western EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Simple_Western_21454.jpg)
![Western Blot EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Western_Blot_21511.jpg)
![Immunocytochemistry EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Immunocytochemistry__Immunofluorescence_17288.jpg)
![EphA8 Antibody [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "EphA8 Antibody [Unconjugated]")
Secondary Antibodies |
Isotype Controls |
Research Areas for EphA10 Antibody (NBP1-83677)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | EPHA10 |
![Western Blot EphA1 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphA1_AF638_Western_Blot_17606.jpg)
![Immunocytochemistry EphA1 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphA1_AF638_Immunocytochemistry__Immunofluorescence_20119.jpg)
![Western Blot EphA2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphA2_AF3035_Knockout_Validated_21256.jpg)
![Immunohistochemistry EphA2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphA2_AF3035_Immunohistochemistry_7327.jpg)
![Flow Cytometry EphA2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphA2_AF3035_Flow_Cytometry_20077.jpg)
![Immunohistochemistry EphA3 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphA3_AF640_Immunohistochemistry_19184.jpg)
![Immunocytochemistry EphB3 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB3_AF432_Immunocytochemistry_10108.jpg)
![Western Blot EphB3 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB3_AF432_Western_Blot_23994.jpg)
![Immunohistochemistry Ephrin-A4 Antibody (135305) [Unconjugated]](https://images.novusbio.com/images2/EphrinA4_MAB369_Immunohistochemistry_21487.jpg)
![SDS-PAGE ErbB2/Her2 [Unconjugated]](https://images.novusbio.com/images2/ErbB2_1129-ER_70.jpg)
![Bioactivity ErbB2/Her2 [Unconjugated]](https://images.novusbio.com/images2/1129-er_recombinant-human-erbb2-her2-fc-chimera-protein-cf-bioactivity-7122020142841.jpg)
![Immunocytochemistry EphA5 Antibody (86731) [Unconjugated]](https://images.novusbio.com/images2/EphA5_MAB541_Immunocytochemistry_6646.jpg)
![Flow Cytometry EphA5 Antibody (86731) [Unconjugated]](https://images.novusbio.com/images2/EphA5_MAB541_Flow_Cytometry_20058.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")