EpCAM/TROP1 Antibody

Images

 
Orthogonal Strategies: Western Blot: EpCAM/TROP1 Antibody [NBP1-89404] - Analysis in human cell lines Caco-2 and U-251MG using anti-EPCAM antibody. Corresponding EPCAM RNA-seq data are presented for the same cell ...read more
Orthogonal Strategies: Immunohistochemistry-Paraffin: EpCAM/TROP1 Antibody [NBP1-89404] - Staining in human rectum and liver tissues using anti-EPCAM antibody. Corresponding EPCAM RNA-seq data are presented for ...read more
Immunohistochemistry-Paraffin: EpCAM/TROP1 Antibody [NBP1-89404] - Staining of human liver shows low expression as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

EpCAM/TROP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYY
Specificity
Specificity of human EpCAM/TROP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EPCAM
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
EpCAM/TROP1 Protein (NBP1-89404PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%), Rat (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for EpCAM/TROP1 Antibody

  • 17-1A
  • 323/A3
  • ACSTD1
  • antigen identified by monoclonal AUA1
  • CD326 antigen
  • CD326
  • Cell surface glycoprotein Trop-1
  • chromosome 4, surface marker (35kD glycoprotein)
  • DIAR5
  • EGP
  • EGP-2
  • EGP314
  • EGP40
  • EpCAM
  • epithelial cell adhesion molecule
  • Epithelial cell surface antigen
  • Epithelial glycoprotein 314
  • Epithelial glycoprotein
  • ESA
  • GA733-2
  • GA733-2EGP34
  • gp40
  • hEGP314
  • HNPCC8
  • KS 1/4 antigen
  • KS1/4
  • KSAHEA125
  • M1S2
  • M4S1
  • M4S1Ly74
  • Major gastrointestinal tumor-associated protein GA733-2
  • MIC18MH99
  • MOC31
  • TACST-1
  • TACSTD1
  • TROP1
  • TROP1CD326
  • Tumor-associated calcium signal transducer 1CO-17A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB100-687
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB5248
Species: Hu
Applications: IHC
NBP1-60046
Species: Hu, Mu, Rt, Po, Bv, Eq, Gt, GP, Rb
Applications: WB, ICC/IF, IHC, IHC-P
NB120-16518
Species: Hu, Mu, Rt, Po
Applications: WB, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-84550
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
NBP2-13967
Species: Hu
Applications: IHC, IHC-P
NB100-77417
Species: Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready

Publications for EpCAM/TROP1 Antibody (NBP1-89404) (0)

There are no publications for EpCAM/TROP1 Antibody (NBP1-89404).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EpCAM/TROP1 Antibody (NBP1-89404) (0)

There are no reviews for EpCAM/TROP1 Antibody (NBP1-89404). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EpCAM/TROP1 Antibody (NBP1-89404). (Showing 1 - 1 of 1 FAQ).

  1. I'm looking for EpCAM antibody for rat. Do you have any antibody which can use FACS?
    • We unfortunately do not have any EpCAM antibodies validated in FACS for detection of the rat protein. I am sorry for any inconvenience. I do have three products to EpCAM that can detect the rat protein. These products have been validated to detect the native rat protein, so they may work for FACS however they have not yet been tested in that particular application. If you would like to try them in your experiment you would qualify for our Innovator's Reward Program. This program was designed to help scientists with the cost of their antibodies in return for valuable information. If you decide to test an antibody in a previously untested species or application we will issue you a credit for the purchase price of the antibody in exchange for a review of your experiment using our product.

Secondary Antibodies

 

Isotype Controls

Additional EpCAM/TROP1 Products

Bioinformatics Tool for EpCAM/TROP1 Antibody (NBP1-89404)

Discover related pathways, diseases and genes to EpCAM/TROP1 Antibody (NBP1-89404). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EpCAM/TROP1 Antibody (NBP1-89404)

Discover more about diseases related to EpCAM/TROP1 Antibody (NBP1-89404).
 

Pathways for EpCAM/TROP1 Antibody (NBP1-89404)

View related products by pathway.

PTMs for EpCAM/TROP1 Antibody (NBP1-89404)

Learn more about PTMs related to EpCAM/TROP1 Antibody (NBP1-89404).
 

Research Areas for EpCAM/TROP1 Antibody (NBP1-89404)

Find related products by research area.

Blogs on EpCAM/TROP1

There are no specific blogs for EpCAM/TROP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EpCAM/TROP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EPCAM
Entrez
Uniprot