Eosinophil derived neurotoxin Antibody

Images

 
Western Blot: Eosinophil derived neurotoxin Antibody [H00006036-B01P] - Analysis of RNASE2 expression in transfected 293T cell line by RNASE2 polyclonal antibody. Lane1:RNASE2 transfected lysate(17.71 KDa). ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Eosinophil derived neurotoxin Antibody Summary

Immunogen
RNASE2 (NP_002925.1, 1 a.a. - 161 a.a.) full-length human protein. MVPKLFTSQICLLLLLGLLAVEGSLHVKPPQFTWAQWFETQHINMTSQQCTNAMQVINNYQRRCKNQNTFLLTTFANVVNVCGNPNMTCPSNKTRKNCHHSGSQVPLIHCNLTTPSPQNISNCRYAQTPANMFYIVACDNRDQRRDPPQYPVVPVHLDRII
Specificity
RNASE2 - ribonuclease, RNase A family, 2 (liver, eosinophil-derived neurotoxin),
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
RNASE2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Eosinophil derived neurotoxin Antibody

  • EC 3.1.27.5
  • EDNRNase 2
  • Eosinophil-derived neurotoxin
  • non-secretory ribonuclease
  • Ribonuclease 2
  • Ribonuclease US
  • ribonuclease, RNase A family, 2 (liver, eosinophil-derived neurotoxin)
  • RNS2RNase UpI-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33778
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13967
Species: Hu
Applications: IHC, IHC-P
NBP1-88573
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-22568
Species: Hu
Applications: IHC-P
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP1-87804
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3667
Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC
NBP1-87688
Species: Hu
Applications: WB, IHC, IHC-P
H00006036-B01P
Species: Hu
Applications: WB

Publications for Eosinophil derived neurotoxin Antibody (H00006036-B01P) (0)

There are no publications for Eosinophil derived neurotoxin Antibody (H00006036-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Eosinophil derived neurotoxin Antibody (H00006036-B01P) (0)

There are no reviews for Eosinophil derived neurotoxin Antibody (H00006036-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Eosinophil derived neurotoxin Antibody (H00006036-B01P). (Showing 1 - 1 of 1 FAQ).

  1. Do you have information as to what epitope these antibodies bind to (H00006036-D01P and H00006036-B01P)? Also, for developing an ELISA method, do you have a recommended concentration to use these antibodies at?
    • FYI, these two antibodies used the same immunogen (RNASE2 [NP_002925.1, 1 a.a. ~ 161 a.a] full-length human protein) to raise the polyclonal antibodies in rabbit (H00006036-D01P) and mouse (H00006036-B01P); and this is only different between them. Since they are polyclonal ones, the epitopes should cover the entire immunogens. Unfortunately, these two antibodies have never been tested together, as a pair, in sandwich-type ELISA (sELISA). They are more expected to work individually as the detection antibodies in ELISA. The users will need to test whether they can work together in the sELISA setting; apologize for any inconvenience. The datasheet for H00006036-B01P says that it is recommended to use dilution 1:100-1:2000 in ELISA. I anticipate that H00006036-D01P should use the similar dilution in ELISA too. In our experiences, sELISA has better to have a monoclonal antibody (or the antibody raised from a smaller immunogen) as the capture antibody, where a polyclonal (or the larger immunogen-derived antibody) as the detection one; so that the protein target is anchored to the surface by using the smaller region/less epitopes while the rest of epitopes can be used by the detection antibody.

Secondary Antibodies

 

Isotype Controls

Additional Eosinophil derived neurotoxin Products

Bioinformatics Tool for Eosinophil derived neurotoxin Antibody (H00006036-B01P)

Discover related pathways, diseases and genes to Eosinophil derived neurotoxin Antibody (H00006036-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Eosinophil derived neurotoxin Antibody (H00006036-B01P)

Discover more about diseases related to Eosinophil derived neurotoxin Antibody (H00006036-B01P).
 

Pathways for Eosinophil derived neurotoxin Antibody (H00006036-B01P)

View related products by pathway.

PTMs for Eosinophil derived neurotoxin Antibody (H00006036-B01P)

Learn more about PTMs related to Eosinophil derived neurotoxin Antibody (H00006036-B01P).
 

Research Areas for Eosinophil derived neurotoxin Antibody (H00006036-B01P)

Find related products by research area.

Blogs on Eosinophil derived neurotoxin

There are no specific blogs for Eosinophil derived neurotoxin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Eosinophil derived neurotoxin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RNASE2
Entrez
Uniprot