Endothelin-1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Endothelin-1 Antibody [NBP1-84779] - staining of human cell line A-431 shows localization to nucleus, nucleoli & the Golgi apparatus. Antibody staining is shown in green
Immunohistochemistry-Paraffin: Endothelin-1 Antibody [NBP1-84779] - Staining of human colon shows moderate cytoplasmic positivity in glandular cells and endothelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Endothelin-1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PYGLGSPRSKRALENLLPTKATDRENRCQCASQKDKKCWNFCQAGKELRAEDIMEKDWNNH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EDN1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Endothelin-1 Recombinant Protein Antigen (NBP1-84779PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Endothelin-1 Antibody

  • EDN1
  • endothelin 1
  • Endothelin-1
  • ET1
  • HDLCQ7
  • PPET1
  • preproendothelin-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4496
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB600-836
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB5579
Species: Hu
Applications: ICC
NB300-500
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-87942
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1784
Species: Hu
Applications: WB, IHC, IP, CyTOF-ready, ICFlow
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF4090
Species: Hu
Applications: WB, IHC, IP, Neut

Publications for Endothelin-1 Antibody (NBP1-84779) (0)

There are no publications for Endothelin-1 Antibody (NBP1-84779).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Endothelin-1 Antibody (NBP1-84779) (0)

There are no reviews for Endothelin-1 Antibody (NBP1-84779). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Endothelin-1 Antibody (NBP1-84779) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Endothelin-1 Products

Bioinformatics Tool for Endothelin-1 Antibody (NBP1-84779)

Discover related pathways, diseases and genes to Endothelin-1 Antibody (NBP1-84779). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Endothelin-1 Antibody (NBP1-84779)

Discover more about diseases related to Endothelin-1 Antibody (NBP1-84779).
 

Pathways for Endothelin-1 Antibody (NBP1-84779)

View related products by pathway.

PTMs for Endothelin-1 Antibody (NBP1-84779)

Learn more about PTMs related to Endothelin-1 Antibody (NBP1-84779).
 

Research Areas for Endothelin-1 Antibody (NBP1-84779)

Find related products by research area.

Blogs on Endothelin-1

There are no specific blogs for Endothelin-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Endothelin-1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EDN1
Entrez