Endostatin Recombinant Protein Antigen

Images

 

Product Details

Summary
Product Discontinued
View other related Endostatin Peptides and Proteins

Order Details


    • Catalog Number
      NBP1-89587PEP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Endostatin Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human COL18A1.

Source: E. coli

Amino Acid Sequence: KDELLFPSWEALFSGSEGPLKPGARIFSFDGKDVLRHPTWPQKSVWHGSDPNGRRLTESYCETWRTEAPSATGQASSLLGGRLLGQSAASCHHAYIVLCIENSFM

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
COL18A1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89587.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Endostatin Recombinant Protein Antigen

  • antiangiogenic agent
  • COL18A1
  • collagen alpha-1(XVIII) chain
  • collagen, type XVIII, alpha 1
  • Endostatin
  • FLJ27325
  • FLJ34914
  • human type XVIII collagen10endostatin
  • KNO
  • KNO1MGC74745
  • Knobloch syndrome, type 1
  • KS
  • multi-functional protein MFP

Background

The extensive family of COL gene products (collagens) is composed of several chain types, including fibril-forming interstitial collagens (types I, II, III and V) and basement membrane collagens (type IV), each type containing multiple isoforms. Collagens are fibrous, extracellular matrix proteins with high tensile strength and are the major components of connective tissue, such as tendons and cartilage. All collagens contain a triple helix domain and frequently show lateral self-association in order to form complex connective tissues. Several collagens also play a role in cell adhesion, important for maintaining normal tissue architecture and function.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

DVE00
Species: Hu
Applications: ELISA
NBP2-12897
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, MiAr, WB
233-FB
Species: Hu
Applications: BA
H00003753-M01
Species: Ca, Gp, Hu, Pm, Rt
Applications: ELISA, ICC/IF, KD, WB
AF226
Species: Hu
Applications: WB
M6000B
Species: Mu
Applications: ELISA
DTSP10
Species: Hu
Applications: ELISA
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-03109
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP2-29429
Species: Bv, Ca, Ch, Hu, Pm, Mu, Rb, Rt, Re, Ze
Applications: CyTOF-reported, Dual ISH-IHC, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Single-Cell Western, WB
NB100-74350
Species: Bv, Ca, Hu, Mu, Po, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NB600-930
Species: Hu, Rt
Applications: ELISA, WB
MMP200
Species: Ca, Hu, Mu, Po, Rt
Applications: ELISA
AF3628
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
AF644
Species: Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Neut, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NB110-41083
Species: Hu
Applications: ChIP, ELISA, ICC/IF, WB
NBP1-89587PEP
Species: Hu
Applications: AC

Publications for Endostatin Protein (NBP1-89587PEP) (0)

There are no publications for Endostatin Protein (NBP1-89587PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Endostatin Protein (NBP1-89587PEP) (0)

There are no reviews for Endostatin Protein (NBP1-89587PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Endostatin Protein (NBP1-89587PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Endostatin Products

Research Areas for Endostatin Protein (NBP1-89587PEP)

Find related products by research area.

Blogs on Endostatin

There are no specific blogs for Endostatin, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Endostatin Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol COL18A1