Endostatin Antibody Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: KDELLFPSWEALFSGSEGPLKPGARIFSFDGKDVLRHPTWPQKSVWHGSDPNGRRLTESYCETWRTEAPSATGQASSLLGGRLLGQSAASCHHAYIVLCIENSFM |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
COL18A1 |
| Purity |
Immunogen affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (80%)
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Immunogen affinity purified |
Alternate Names for Endostatin Antibody
Background
The extensive family of COL gene products (collagens) is composed of several chain types, including fibril-forming interstitial collagens (types I, II, III and V) and basement membrane collagens (type IV), each type containing multiple isoforms. Collagens are fibrous, extracellular matrix proteins with high tensile strength and are the major components of connective tissue, such as tendons and cartilage. All collagens contain a triple helix domain and frequently show lateral self-association in order to form complex connective tissues. Several collagens also play a role in cell adhesion, important for maintaining normal tissue architecture and function.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
Species: Hu
Applications: BA
Species: Ca, Gp, Hu, Pm, Rt
Applications: ELISA, ICC/IF, KD, WB
Species: Hu
Applications: WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Bv, Ca, Ch, Hu, Pm, Mu, Rb, Rt, Re, Ze
Applications: COMET, CyTOF-reported, Dual ISH-IHC, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, mIF, Single-Cell Western, WB
Species: Hu
Applications: BA
Species: Bv, Ca, Hu, Mu, Po, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: WB
Species: Ca, Hu, Mu, Po, Rt
Applications: ELISA
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Neut, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: ELISA, WB
Species: Hu
Applications: WB, IHC
Publications for Endostatin Antibody (NBP1-89587) (0)
There are no publications for Endostatin Antibody (NBP1-89587).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Endostatin Antibody (NBP1-89587) (0)
There are no reviews for Endostatin Antibody (NBP1-89587).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Endostatin Antibody (NBP1-89587) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Endostatin Products
Research Areas for Endostatin Antibody (NBP1-89587)
Find related products by research area.
|
Blogs on Endostatin