Endostatin Antibody

Images

 
Immunohistochemistry: Endostatin Antibody [NBP1-89587] - Staining of human duodenum shows moderate cytoplasmic and nuclear positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Endostatin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KDELLFPSWEALFSGSEGPLKPGARIFSFDGKDVLRHPTWPQKSVWHGSDPNGRRLTESYCETWRTEAPSATGQASSLLGGRLLGQSAASCHHAYIVLCIENSFM
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
COL18A1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Endostatin Protein (NBP1-89587PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%), Rat (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Endostatin Antibody

  • antiangiogenic agent
  • COL18A1
  • collagen alpha-1(XVIII) chain
  • collagen, type XVIII, alpha 1
  • Endostatin
  • FLJ27325
  • FLJ34914
  • human type XVIII collagen10endostatin
  • KNO
  • KNO1MGC74745
  • Knobloch syndrome, type 1
  • KS
  • multi-functional protein MFP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-12897
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00003753-M01
Species: Hu
Applications: WB, ELISA, RNAi
AF226
Species: Hu
Applications: WB
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-43648
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-12154
Species: Hu
NB100-2756
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-74350
Species: Hu, Mu, Rt, Po, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-930
Species: Hu, Ba
Applications: WB, ELISA
NB200-193
Species: Hu, Mu, Rt, Ch, GP
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-1642
Species: Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP, Flow-CS
AF644
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB110-41083
Species: Hu
Applications: WB, ChIP, ELISA

Publications for Endostatin Antibody (NBP1-89587) (0)

There are no publications for Endostatin Antibody (NBP1-89587).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Endostatin Antibody (NBP1-89587) (0)

There are no reviews for Endostatin Antibody (NBP1-89587). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Endostatin Antibody (NBP1-89587) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Endostatin Products

Bioinformatics Tool for Endostatin Antibody (NBP1-89587)

Discover related pathways, diseases and genes to Endostatin Antibody (NBP1-89587). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Endostatin Antibody (NBP1-89587)

Discover more about diseases related to Endostatin Antibody (NBP1-89587).
 

Pathways for Endostatin Antibody (NBP1-89587)

View related products by pathway.

PTMs for Endostatin Antibody (NBP1-89587)

Learn more about PTMs related to Endostatin Antibody (NBP1-89587).
 

Research Areas for Endostatin Antibody (NBP1-89587)

Find related products by research area.

Blogs on Endostatin

There are no specific blogs for Endostatin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Endostatin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol COL18A1
Entrez