Enah/Vasp-like Antibody

Western Blot: Enah/Vasp-like Antibody [NBP2-38132] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line MOLT-4

Immunocytochemistry/Immunofluorescence: Enah/Vasp-like Antibody [NBP2-38132] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Enah/Vasp-like Antibody [NBP2-38132] - Staining of human lung shows moderate to strong cytoplasmic positivity in macrophages.

Immunohistochemistry-Paraffin: Enah/Vasp-like Antibody [NBP2-38132] - Staining of human lung, lymph node, skeletal muscle and small intestine using Anti-EVL antibody NBP2-38132 (A) shows similar protein distribution across tissues to independent antibody NBP1-80831 (B).

Immunohistochemistry-Paraffin: Enah/Vasp-like Antibody [NBP2-38132] - Analysis in human lymph node and skeletal muscle tissues. Corresponding EVL RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Enah/Vasp-like Antibody [NBP2-38132] - Staining of human lymph node shows moderate to strong cytoplasmic positivity in non-germinal center cells.

Immunohistochemistry-Paraffin: Enah/Vasp-like Antibody [NBP2-38132] - Staining of human small intestine shows moderate to strong cytoplasmic positivity in lymphoid cells.

Immunohistochemistry-Paraffin: Enah/Vasp-like Antibody [NBP2-38132] - Staining of human kidney shows no positivity in cells in tubules as expected.

Immunohistochemistry-Paraffin: Enah/Vasp-like Antibody [NBP2-38132] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Simple Western: Enah/Vasp-like Antibody [NBP2-38132] - Simple Western lane view shows a specific band for Enah/Vasp-like in 0.2 mg/ml of MOLT-4 lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation system.

Simple Western: Enah/Vasp-like Antibody [NBP2-38132] - Electropherogram image of the corresponding Simple Western lane view. Enah/Vasp-like antibody was used at 1:25 dilution on MOLT-4 lysate(s) respectively.

Product Discontinued

Enah/Vasp-like Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: SNSVEKPVSSILSRMKPAGSVNDMALDAFDLDRMKQEILEEVVRELHKVKEEIIDAIRQELSGI
• Predicted Species: Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EVL
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Simple Western 1:25
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Enah/Vasp-like Antibody

• ena/VASP-like protein
• Enah/Vasp-like
• RNB6Ena/vasodilator-stimulated phosphoprotein-like

Background

Enah/Vasp-like (EVL) is a member of the Ena/VASP protein family. Ena/VASP proteins are actin-associated proteins involved in a range of processes that require dynamic actin remodeling such as axon guidance and lamellipodial and filopodial dynamics in migrating cells. EVL enhances actin nucleation and polymerization.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: EVL