EMP/MAEA Antibody - BSA Free

Western Blot: EMP/MAEA Antibody [NBP3-10675] - Western blot analysis of EMP/MAEA in HepG2 Whole Cell lysates. Antibody dilution at 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

EMP/MAEA Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit EMP/MAEA Antibody - BSA Free (NBP3-10675) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human EMP/MAEA. Peptide sequence KAVESIQAEDESAKLCKRRIEHLKEHSSDQPAAASVWKRKRMDRMMVEHL
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MAEA
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 43 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for EMP/MAEA Antibody - BSA Free

• EMLP
• EMP
• EMPCell proliferation-inducing gene 5 protein
• Erythroblast macrophage protein
• HLC-10
• Human lung cancer oncogene 10 protein
• lung cancer-related protein 10
• macrophage erythroblast attacher
• MAEA
• PIG5
• proliferation-inducing gene 5

Background

The MAEA gene product mediates the attachment of erythroblasts to macrophages. This attachment promotes terminal maturationand enucleation of erythroblasts, presumably by suppressing apoptosis. This protein is an integral membrane proteinwith the N-terminus o

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MAEA