EMID2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: EMID2 Antibody [NBP2-59788] - Staining of human cell line U-2 OS shows localization to vesicles. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: EMID2 Antibody [NBP2-59788] - Staining of human vagina shows distinct positivity in extracellular matrix.

• Reactivity: Hu, Mu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

EMID2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acid sequence: ANLVSYRTLIRPTYRVSYRTVTVLEWRCCPGFTGSNCDEECMNCTRLSDMSERLTTLEAKVLLLEAAERPSSPDNDLPAPESTPPTWNEDFLPDAIPLAHPVP
• Predicted Species: Mouse (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EMID2
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  EMID2 Recombinant Protein Antigen (NBP2-59788PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Protein A purified

Alternate Names for EMID2 Antibody - BSA Free

• COL26A1
• EMI domain containing 2
• EMI domain-containing protein 2
• Emilin and multimerin domain-containing protein 2
• emilin and multimerin-domain containing protein 2
• EMU2
• Emu2type XXVI, alpha 1
• hEmu2
• KIAA1299
• MGC129848
• putative emu2
• SH2B
• SH2B1

Background

The EMID2 gene (often known as COL26A1) encodes a collagen alpha-1(XXVI) chain that in isoform 1 is 441 amino acids long at 45 kDA and in isoform 2 is 439 amino acids long at 45 kDA. EMID2 participates in the secretion of collagens, the degradation of the extracellular matrix, and collagen biosynthesis and modifying enzymes. It has been known to interact with various genes such as TBP, EMID1, COL14A1, COL15A1, and SERPINH1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: EMID2