SH2B2 Antibody

Images

 
Western Blot: SH2B2 Antibody [NBP2-13305] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: SH2B2 Antibody [NBP2-13305] - Immunofluorescent staining of human cell line MCF7 shows localization to cytosol.
Immunohistochemistry-Paraffin: SH2B2 Antibody [NBP2-13305] - Staining of human prostate shows moderate cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SH2B2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RDKWTRRLRLSRTLAAKVELVDIQREGALRFMVADD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SH2B2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SH2B2 Protein (NBP2-13305PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SH2B2 Antibody

  • adaptor protein with pleckstrin homology and src homology 2 domains
  • APSAdapter protein with pleckstrin homology and Src homology 2 domains
  • SH2 and PH domain-containing adapter protein APS
  • SH2B adapter protein 2
  • SH2B adaptor protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15139
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24557
Species: Hu, Eq, Pm
Applications: WB, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
MAB6184
Species: Mu
Applications: WB, CyTOF-ready, ICFlow
NBP2-37574
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-07799
Species: Hu
NBP2-52414
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready, ICC, IF
NBP2-00641
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-12793
Species: Hu, Mu
Applications: WB, IP
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF6915
Species: Hu, Mu, Rt
Applications: WB
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
NBP2-13305
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SH2B2 Antibody (NBP2-13305) (0)

There are no publications for SH2B2 Antibody (NBP2-13305).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SH2B2 Antibody (NBP2-13305) (0)

There are no reviews for SH2B2 Antibody (NBP2-13305). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SH2B2 Antibody (NBP2-13305) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SH2B2 Products

SH2B2 NBP2-13305

Bioinformatics Tool for SH2B2 Antibody (NBP2-13305)

Discover related pathways, diseases and genes to SH2B2 Antibody (NBP2-13305). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SH2B2 Antibody (NBP2-13305)

Discover more about diseases related to SH2B2 Antibody (NBP2-13305).
 

Pathways for SH2B2 Antibody (NBP2-13305)

View related products by pathway.

PTMs for SH2B2 Antibody (NBP2-13305)

Learn more about PTMs related to SH2B2 Antibody (NBP2-13305).

Blogs on SH2B2

There are no specific blogs for SH2B2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SH2B2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SH2B2