ELAVL2 Antibody


Immunocytochemistry/ Immunofluorescence: ELAVL2 Antibody [NBP2-38012] - Staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ELAVL2 Antibody [NBP2-38012] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: ELAVL2 Antibody [NBP2-38012] - Analysis in human cerebral cortex and skeletal muscle tissues. Corresponding ELAVL2 RNA-seq data are presented for the same ...read more
Immunohistochemistry-Paraffin: ELAVL2 Antibody [NBP2-38012] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

ELAVL2 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: MAVRLCDVASLLRSGSWAAEPWTGQVIAAMETQLSNGPTCNNTANGPTTINNNCSSPVDSGNTEDSKTNL
Specificity of human ELAVL2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ELAVL2 Protein (NBP2-38012PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ELAVL2 Antibody

  • ELAV (embryonic lethal, abnormal vision, Drosophila)-like 2 (Hu antigen B)
  • ELAV-like neuronal protein 1
  • ELAV-like protein 2
  • HELN1
  • HEL-N1
  • Hu-antigen B
  • HuB
  • HUBELAV (embryonic lethal, abnormal vision, Drosophila)-like 2
  • Nervous system-specific RNA-binding protein Hel-N1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Rt
Applications: WB, ELISA, IHC-P, RNAi
Species: Hu, Mu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu, Mu, Rt, Rb
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, ChIP, Flow, GS, ICC/IF, IP, CyTOF-ready
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ICC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ELAVL2 Antibody (NBP2-38012) (0)

There are no publications for ELAVL2 Antibody (NBP2-38012).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ELAVL2 Antibody (NBP2-38012) (0)

There are no reviews for ELAVL2 Antibody (NBP2-38012). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ELAVL2 Antibody (NBP2-38012) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for ELAVL2 Antibody (NBP2-38012)

Discover related pathways, diseases and genes to ELAVL2 Antibody (NBP2-38012). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ELAVL2 Antibody (NBP2-38012)

Discover more about diseases related to ELAVL2 Antibody (NBP2-38012).

Pathways for ELAVL2 Antibody (NBP2-38012)

View related products by pathway.

PTMs for ELAVL2 Antibody (NBP2-38012)

Learn more about PTMs related to ELAVL2 Antibody (NBP2-38012).

Research Areas for ELAVL2 Antibody (NBP2-38012)

Find related products by research area.

Blogs on ELAVL2

There are no specific blogs for ELAVL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ELAVL2 Antibody and receive a gift card or discount.


Gene Symbol ELAVL2