ELA3A Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ELA3A Antibody [NBP2-58716] - Staining of human cell line U-2 OS shows localization to cytosol.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ELA3A Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: HTCGGSLIAPDWVVTAGHCISRDLTYQVVLGEYNLAVKEGPEQVIPINSEELFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDIL
Specificity
Specificity of human ELA3A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CELA3A
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ELA3A Recombinant Protein Antigen (NBP2-58716PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for ELA3A Antibody

  • chymotrypsin-like elastase family member 3A
  • chymotrypsin-like elastase family, member 3A
  • EC 3.4.21
  • EC 3.4.21.70
  • ELA3A
  • ELA3elastase 1
  • elastase 3A, pancreatic (protease E)
  • elastase 3A, pancreatic
  • Elastase IIIA
  • elastase-3A
  • Protease E

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-47645
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
H00006690-M01
Species: Hu
Applications: WB, ELISA, IHC-P, IP
H00001990-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB100-2076
Species: Hu, Po, Ca, Fe, Gt, GP, Sh
Applications: WB, IHC, IHC-P
NBP2-32569
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB41281
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
AF4478
Species: Hu
Applications: WB, IHC
MAB2669
Species: Hu
Applications: WB, Simple Western, IHC
H00005670-Q01
Species: Hu
MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
H00063036-P01
Species: Hu
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF4937
Species: Hu
Applications: WB, IHC
NBP2-03523
Species: Hu, Ca
Applications: WB, Flow
AF3848
Species: Hu
Applications: WB, IHC, IP
NBP2-62664
Species: Hu
Applications: IHC, IHC-P

Publications for ELA3A Antibody (NBP2-58716) (0)

There are no publications for ELA3A Antibody (NBP2-58716).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ELA3A Antibody (NBP2-58716) (0)

There are no reviews for ELA3A Antibody (NBP2-58716). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ELA3A Antibody (NBP2-58716) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for ELA3A Antibody (NBP2-58716)

Discover related pathways, diseases and genes to ELA3A Antibody (NBP2-58716). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for ELA3A Antibody (NBP2-58716)

Find related products by research area.

Blogs on ELA3A

There are no specific blogs for ELA3A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ELA3A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CELA3A