CELA1 Antibody (4H5)

Images

 
Immunocytochemistry/ Immunofluorescence: CELA1 Antibody (4H5) [H00001990-M02] - Analysis of monoclonal antibody to ELA1 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: CELA1 Antibody (4H5) [H00001990-M02] - Analysis of monoclonal antibody to ELA1 on formalin-fixed paraffin-embedded human liver. Antibody concentration 3 ug/ml.
Sandwich ELISA: CELA1 Antibody (4H5) [H00001990-M02] - Detection limit for recombinant GST tagged ELA1 is 3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC-P
Clone
4H5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CELA1 Antibody (4H5) Summary

Immunogen
ELA1 (NP_001962.3 159 a.a. - 257 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LAQTLQQAYLPSVDYAICSSSSYWGSTVKNTMVCAGGDGVRSGCQGDSGGPLHCLVNGKYSVHGVTSFVSSRGCNVSRKPTVFTQVSAYISWINNVIAS
Specificity
Reacts with elastase 1, pancreatic.
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CELA1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
Application Notes
This antibody is reactive against recombinant protein in WB and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CELA1 Antibody (4H5)

  • chymotrypsin-like elastase family member 1
  • chymotrypsin-like elastase family, member 1
  • EC 3.4.21
  • EC 3.4.21.36
  • ELA1elastase-1
  • elastase 1, pancreatic
  • Elastase-1

Background

Elastases form a subfamily of serine proteases that hydrolyze many proteins in addition to elastin. Humans have six elastase genes which encode the structurally similar proteins elastase 1, 2, 2A, 2B, 3A, and 3B. Unlike other elastases, pancreatic elastase 1 is not expressed in the pancreas. To date, elastase 1 expression has only been detected in skin keratinocytes. Clinical literature that describes human elastase 1 activity in the pancreas or fecal material is actually referring to chymotrypsin-like elastase family, member 3B. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-47645
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
AF9024
Species: Mu, Rt
Applications: WB, IHC
NBP2-13961
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB25031
Species: Hu
Applications: WB, IHC, IP
MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
H00010136-M02
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
H00006690-M01
Species: Hu
Applications: WB, ELISA, IHC-P, IP
NBP2-48988
Species: Hu
Applications: IHC
MAB5018
Species: Hu
Applications: WB, IP
NB100-2076
Species: Hu, Po, Ca, Fe, Gt, GP, Sh
Applications: WB, IHC, IHC-P
AF3848
Species: Hu
Applications: WB, IHC, IP
MAB2669
Species: Hu
Applications: WB, Simple Western, IHC
NBL1-10218
Species: Hu
NBP1-35641
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF2419
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP2-12553
Species: Hu
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready

Publications for CELA1 Antibody (H00001990-M02) (0)

There are no publications for CELA1 Antibody (H00001990-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CELA1 Antibody (H00001990-M02) (0)

There are no reviews for CELA1 Antibody (H00001990-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CELA1 Antibody (H00001990-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CELA1 Products

Bioinformatics Tool for CELA1 Antibody (H00001990-M02)

Discover related pathways, diseases and genes to CELA1 Antibody (H00001990-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CELA1 Antibody (H00001990-M02)

Discover more about diseases related to CELA1 Antibody (H00001990-M02).
 

Pathways for CELA1 Antibody (H00001990-M02)

View related products by pathway.

PTMs for CELA1 Antibody (H00001990-M02)

Learn more about PTMs related to CELA1 Antibody (H00001990-M02).

Blogs on CELA1

There are no specific blogs for CELA1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CELA1 Antibody (4H5) and receive a gift card or discount.

Bioinformatics

Gene Symbol CELA1
Entrez
Uniprot