eIF4GII Antibody


Immunohistochemistry-Paraffin: eIF4GII Antibody [NBP1-84866] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: eIF4GII Antibody [NBP1-84866] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.
Immunohistochemistry-Paraffin: eIF4GII Antibody [NBP1-84866] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: eIF4GII Antibody [NBP1-84866] - Staining in human testis and skeletal muscle tissues using anti-EIF4G3 antibody. Corresponding EIF4G3 RNA-seq data are presented for the same tissues.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

eIF4GII Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: VARSTIAAPTSSALSSQPIFTTAIDDRCELSSPREDTIPIPSLTSCTETSDPLPTNENDDDICKKPCSVAPNDIPLV
Specificity of human eIF4GII antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
eIF4GII Protein (NBP1-84866PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for eIF4GII Antibody

  • eIF-4G 3
  • eIF-4-gamma 3
  • eIF-4-gamma II
  • eIF4GIIeIF4G 3
  • eukaryotic translation initiation factor 4 gamma 3
  • eukaryotic translation initiation factor 4 gamma, 3


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Rt, Po
Applications: WB, IP
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu, Ca, Ch, Pm
Applications: WB, Simple Western, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, KO
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC-P
Species: Hu, Bv, Ca, Pm, Xp, Dr(-), Mu(-)
Applications: WB, ELISA, Flow, ICC/IF, IP, MiAr, CyTOF-ready
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IP
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, IHC

Publications for eIF4GII Antibody (NBP1-84866) (0)

There are no publications for eIF4GII Antibody (NBP1-84866).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for eIF4GII Antibody (NBP1-84866) (0)

There are no reviews for eIF4GII Antibody (NBP1-84866). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for eIF4GII Antibody (NBP1-84866) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional eIF4GII Products

Bioinformatics Tool for eIF4GII Antibody (NBP1-84866)

Discover related pathways, diseases and genes to eIF4GII Antibody (NBP1-84866). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for eIF4GII Antibody (NBP1-84866)

Discover more about diseases related to eIF4GII Antibody (NBP1-84866).

Pathways for eIF4GII Antibody (NBP1-84866)

View related products by pathway.

PTMs for eIF4GII Antibody (NBP1-84866)

Learn more about PTMs related to eIF4GII Antibody (NBP1-84866).

Blogs on eIF4GII

There are no specific blogs for eIF4GII, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our eIF4GII Antibody and receive a gift card or discount.


Gene Symbol EIF4G3