Recombinant Human eIF4A2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human eIF4A2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-100 of Human EIF4A2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSGGSADYNREHGGPEGMDPDGVIESNWNEIVDNFDDMNLKESLLRGIYAYGFEKPSAIQQRAIIPCIKGYDVIAQAQSGTGKTATFAISILQQLEIEFK

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
EIF4A2
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human eIF4A2 Protein

  • ATP-dependent RNA helicase eIF4A-2
  • BM-010
  • DDX2Beukaryotic translation initiation factor 4A, isoform 2
  • EC 3.6.1
  • EC 3.6.4.13
  • EIF4A
  • eIF-4A-II
  • eIF4A-II
  • EIF4F
  • eukaryotic initiation factor 4A-II
  • eukaryotic translation initiation factor 4A
  • eukaryotic translation initiation factor 4A2

Background

EIF4A2 - eukaryotic translation initiation factor 4A, isoform 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-268
Species: Hu, Rt, Po
Applications: WB, IP
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NB200-157
Species: Hu
Applications: WB, IHC, IHC-P
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NB100-93308
Species: Hu
Applications: WB, IP
NB100-1595
Species: Hu, Mu
Applications: WB, IHC-P, IP
NB120-6125
Species: Hu, Bv, Ca, Pm, Xp, Dr(-), Mu(-)
Applications: WB, ELISA, Flow, ICC/IF, IP, MiAr, CyTOF-ready
H00008569-M14
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-87799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83302
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-00702
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-85310
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF8962
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP1-83057
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00008894-M09
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP1-19270
Species: Hu, Mu, Rt, Po, Bv, Ca, Rb
Applications: WB, IHC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
H00001974-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for eIF4A2 Partial Recombinant Protein (H00001974-Q01) (0)

There are no publications for eIF4A2 Partial Recombinant Protein (H00001974-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for eIF4A2 Partial Recombinant Protein (H00001974-Q01) (0)

There are no reviews for eIF4A2 Partial Recombinant Protein (H00001974-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for eIF4A2 Partial Recombinant Protein (H00001974-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional eIF4A2 Products

Bioinformatics Tool for eIF4A2 Partial Recombinant Protein (H00001974-Q01)

Discover related pathways, diseases and genes to eIF4A2 Partial Recombinant Protein (H00001974-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for eIF4A2 Partial Recombinant Protein (H00001974-Q01)

Discover more about diseases related to eIF4A2 Partial Recombinant Protein (H00001974-Q01).
 

Pathways for eIF4A2 Partial Recombinant Protein (H00001974-Q01)

View related products by pathway.

Research Areas for eIF4A2 Partial Recombinant Protein (H00001974-Q01)

Find related products by research area.

Blogs on eIF4A2

There are no specific blogs for eIF4A2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

c-Myc Antibody
NB600-335
eIF4A2 Antibody
NBP2-24529
4EBP1 Antibody
NB200-157

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human eIF4A2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol EIF4A2