eIF4A1 Antibody - Azide and BSA Free

Western Blot: eIF4A1 Antibody [NBP3-04718] - Western blot analysis of extracts of various cell lines, using eIF4A1 antibody (NBP3-04718) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.

Immunocytochemistry/ Immunofluorescence: eIF4A1 Antibody - Azide and BSA Free [eIF4A1] - Immunofluorescence analysis of U2OS cells using eIF4A1 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: eIF4A1 Antibody - Azide and BSA Free [eIF4A1] - Immunofluorescence analysis of C6 cells using eIF4A1 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: eIF4A1 Antibody - Azide and BSA Free [eIF4A1] - Immunofluorescence analysis of U2OS cells using eIF4A1 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: eIF4A1 Antibody - Azide and BSA Free [eIF4A1] - Immunofluorescence analysis of NIH/3T3 cells using eIF4A1 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: eIF4A1 Antibody - Azide and BSA Free [eIF4A1] - Immunofluorescence analysis of C6 cells using eIF4A1 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: eIF4A1 Antibody - Azide and BSA Free [eIF4A1] - Immunofluorescence analysis of NIH/3T3 cells using eIF4A1 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

eIF4A1 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit eIF4A1 Antibody - Azide and BSA Free (NBP3-04718) is a polyclonal antibody validated for use in WB, ICC/IF and IP. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human eIF4A1 (NP_001407.1). MSASQDSRSRDNGPDGMEPEGVIESNWNEIVDSFDDMNLSESLLRGIYAYGFEKPSAIQQRAILPCIKGYDVIAQAQSGTGKTATFAISILQQIELDLKA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EIF4A1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunoprecipitation 1:500 - 1:1000
  • Western Blot 1:1000 - 1:5000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for eIF4A1 Antibody - Azide and BSA Free

• ATP-dependent RNA helicase eIF4A-1
• DDX2Aeukaryotic initiation factor 4A-I
• EC 3.6.1
• EC 3.6.4.13
• EIF4A
• EIF-4A
• eIF-4A-I
• eIF4A-I
• eukaryotic initiation factor 4AI
• eukaryotic translation initiation factor 4A
• eukaryotic translation initiation factor 4A, isoform 1
• eukaryotic translation initiation factor 4A1

Background

ATP-dependent RNA helicase which is a subunit of the eIF4F complex involved in cap recognition and isrequired for mRNA binding to ribosome. In the current model of translation initiation, eIF4A unwinds RNA secondarystructures in the 5'-UTR of mRNAs which is necessary to allow efficient binding of the small ribosomal subunit, andsubsequent scanning for the initiator codon

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: EIF4A1