EIF1A Antibody

Images

 
Western Blot: EIF1A Antibody [NBP1-85808] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells). Lane 3: PC12 cell lysate (Pheochromocytoma of rat ...read more
Immunohistochemistry-Paraffin: EIF1A Antibody [NBP1-85808] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Western Blot: EIF1A Antibody [NBP1-85808] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Western Blot: EIF1A Antibody [NBP1-85808] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Mouse Cerebral Cortex tissue
Immunohistochemistry-Paraffin: EIF1A Antibody [NBP1-85808] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: EIF1A Antibody [NBP1-85808] - Staining of human endometrium shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: EIF1A Antibody [NBP1-85808] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EIF1A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KRELVFKEDGQEYAQVIKMLGNGRLEALCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQ
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EIF1AX
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
EIF1AY Recombinant Protein Antigen (NBP1-85808PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for EIF1A Antibody

  • eIF-1A
  • EIF1AP1
  • EIF4C
  • eIF-4C
  • eukaryotic translation initiation factor 1A, X chromosome
  • eukaryotic translation initiation factor 1A, X-chromosomal
  • eukaryotic translation initiation factor 1A, Y chromosome
  • eukaryotic translation initiation factor 1A, Y-chromosomal
  • Eukaryotic translation initiation factor 4C
  • FLJ45762
  • Putative eukaryotic translation initiation factor 1A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-00702
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP3-03412
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP1-31528
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-16311
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-24529
Species: Ca, Ch, Hu, Mu, Pm
Applications: IHC, IHC-P, Simple Western, WB
NBP2-24632
Species: Ca, Ch, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
NB100-268
Species: Hu, Po
Applications: IP, WB
NB100-81898
Species: Hu, Po
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-37488
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-67591
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-02669
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF2009
Species: Hu
Applications: ICC, IHC
AF7895
Species: Hu
Applications: IHC, WB
MAB1759
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow, WB
H00008894-M09
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
AF5738
Species: Hu
Applications: ICC, KO, WB
NBP1-31113
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-88376
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB

Publications for EIF1A Antibody (NBP1-85808) (0)

There are no publications for EIF1A Antibody (NBP1-85808).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EIF1A Antibody (NBP1-85808) (0)

There are no reviews for EIF1A Antibody (NBP1-85808). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EIF1A Antibody (NBP1-85808) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EIF1A Products

Array NBP1-85808

Bioinformatics Tool for EIF1A Antibody (NBP1-85808)

Discover related pathways, diseases and genes to EIF1A Antibody (NBP1-85808). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EIF1A Antibody (NBP1-85808)

Discover more about diseases related to EIF1A Antibody (NBP1-85808).
 

Pathways for EIF1A Antibody (NBP1-85808)

View related products by pathway.

Blogs on EIF1A

There are no specific blogs for EIF1A, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EIF1A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EIF1AX