EIF4A3 Antibody


Western Blot: EIF4A3 Antibody [NBP1-85268] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: EIF4A3 Antibody [NBP1-85268] - Staining of human cell line U-2 OS shows localization to nucleoplasm.
Orthogonal Strategies: Immunohistochemistry-Paraffin: EIF4A3 Antibody [NBP1-85268] - Staining in human testis and pancreas tissues using anti-EIF4A3 antibody. Corresponding EIF4A3 RNA-seq data are presented for ...read more
Immunohistochemistry-Paraffin: EIF4A3 Antibody [NBP1-85268] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: EIF4A3 Antibody [NBP1-85268] - Staining of human testis shows high expression.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

EIF4A3 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: MATTATMATSGSARKRLLKEEDMTKVEFETSEEVDVTPTFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIK
Specificity of human EIF4A3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (99%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
EIF4A3 Protein (NBP1-85268PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for EIF4A3 Antibody

  • ATP-dependent RNA helicase DDX48
  • ATP-dependent RNA helicase eIF4A-3
  • DDX48
  • DEAD (Asp-Glu-Ala-Asp) box polypeptide 48
  • DEAD box protein 48
  • DKFZp686O16189
  • EC 3.6.1
  • EC
  • eIF-4A-III
  • eIF4A-III
  • eukaryotic initiation factor 4A-III
  • Eukaryotic initiation factor 4A-like NUK-34
  • Eukaryotic translation initiation factor 4A isoform 3
  • eukaryotic translation initiation factor 4A
  • eukaryotic translation initiation factor 4A3
  • hNMP 265
  • KIAA0111eukaryotic translation initiation factor 4A, isoform 3
  • MGC10862
  • NMP 265
  • NMP265
  • Nuclear matrix protein 265
  • NUK34


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC-P
Species: Hu
Applications: WB (-), IHC, IHC-P, IP
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Ca, Ch, Pm
Applications: WB, Simple Western, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Rt, Po
Applications: WB, IP
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IP, PLA
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu, Mu, Rt
Applications: WB, ELISA
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA, KD
Species: Mu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, ICC, IF

Publications for EIF4A3 Antibody (NBP1-85268) (0)

There are no publications for EIF4A3 Antibody (NBP1-85268).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EIF4A3 Antibody (NBP1-85268) (0)

There are no reviews for EIF4A3 Antibody (NBP1-85268). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for EIF4A3 Antibody (NBP1-85268) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional EIF4A3 Products

Bioinformatics Tool for EIF4A3 Antibody (NBP1-85268)

Discover related pathways, diseases and genes to EIF4A3 Antibody (NBP1-85268). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EIF4A3 Antibody (NBP1-85268)

Discover more about diseases related to EIF4A3 Antibody (NBP1-85268).

Pathways for EIF4A3 Antibody (NBP1-85268)

View related products by pathway.

PTMs for EIF4A3 Antibody (NBP1-85268)

Learn more about PTMs related to EIF4A3 Antibody (NBP1-85268).

Blogs on EIF4A3

There are no specific blogs for EIF4A3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our EIF4A3 Antibody and receive a gift card or discount.


Gene Symbol EIF4A3