eIF3e Antibody - BSA Free Summary
Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-445 of human eIF3e (NP_001559.1). MAEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKNLYSDDIPHALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADKHGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQNWDAAMEDLTRLKETIDNNSVSSPLQSLQQRTWLIHWSLFVFFNHPKGRDNIIDLFLYQPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVECLYVNFDFDGAQKKLRECESVLVNDFFLVACLEDFIENARLFIFETFCRIHQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEKTKSLSFRSQMLAMNIEKKLNQNSRSEAPNWATQDSGFY |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
EIF3E |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Western Blot 1:500 - 1:2000
|
Theoretical MW |
52 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.3), 50% glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for eIF3e Antibody - BSA Free
Background
Int6 is a candidate tumor suppressor in multiple neoplasms, and in particular, breast and lung cancers. The Int6 locus was initially identified as a common insertion site (CIS) in a genetic screen for transforming sequences in a breast cancer mouse model system. Insertion of mouse mammary tumor virus (MMTV) into this locus results in the production of an amino-terminal truncated gene product. Expression of the truncated Int6 product corresponds to cellular transformation in both in vivo and in vitro systems. This gene product plays a role in regulating translation initiation and is a component of the eIF3 translation initiation complex. There is evidence that suggests that Int6 may impart a negative role in the general translational machinery while promoting an increase in the expression of a subset of stressresponsive genes. Taken together, it is of great interest to further study the mechanism by which Int6 is involved in regulating cell growth.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Ca, Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Po
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC, WB
Species: Hu
Applications: BA
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
Species: Fi, Ha, Hu, Mu, Pm, Rb, Rt, Re, Sh
Applications: ChIP, Dual ISH-IHC, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, KO, PAGE, Simple Western, WB
Species: Hu, Mu, Pm, Rt, Ze
Applications: WB
Species: Hu, Po
Applications: IP, WB
Species: Hu, Mu
Applications: WB
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: WB
Publications for eIF3e Antibody (NBP3-04723) (0)
There are no publications for eIF3e Antibody (NBP3-04723).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for eIF3e Antibody (NBP3-04723) (0)
There are no reviews for eIF3e Antibody (NBP3-04723).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for eIF3e Antibody (NBP3-04723) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional eIF3e Products
Blogs on eIF3e