eIF2B1 Antibody - BSA Free

Western Blot: eIF2B1 Antibody [NBP2-58544] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.

Immunocytochemistry/Immunofluorescence: eIF2B1 Antibody [NBP2-58544] - Staining of human cell line U-2 OS shows localization to cytosol.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

eIF2B1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit eIF2B1 Antibody - BSA Free (NBP2-58544) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: AKAQNKPFYVVAESFKFVRLFPLNQQDVPDKFKYKADTLKVAQTGQDLKEEHPWVDYTAPSLITLLFTDLGVLTPSAVSDELIKLYL
• Predicted Species: Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EIF2B1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  eIF2B1 Recombinant Protein Antigen (NBP2-58544PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for eIF2B1 Antibody - BSA Free

• eIF-2B GDP-GTP exchange factor subunit alpha
• EIF2B
• EIF-2B
• EIF-2Balpha
• EIF2BAMGC117409
• eukaryotic translation initiation factor 2B, subunit 1 (alpha, 26kD)
• eukaryotic translation initiation factor 2B, subunit 1 alpha, 26kDa
• MGC125868
• MGC125869
• translation initiation factor eIF-2B subunit alpha

Background

The eIF2B1 gene encodes one of five subunits of eukaryotic translation initiation factor 2B (EIF2B), a GTP exchange factorfor eukaryotic initiation factor 2 and an essential regulator for protein synthesis. Mutations in this gene and thegenes encoding other EIF

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: EIF2B1