EHF Antibody - BSA Free

Western Blot: EHF Antibody [NBP2-56705] - Analysis in human cell line TD47D.

Immunocytochemistry/Immunofluorescence: EHF Antibody [NBP2-56705] - Staining of human cell line A-431 shows localization to nucleoplasm & the Golgi apparatus. Antibody staining is shown in green.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

EHF Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit EHF Antibody - BSA Free (NBP2-56705) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MILEGGGVMNLNPGNNLLHQPPAWTDSYSTCNVSSGFFGGQWHEIHPQYWTKYQVWEWLQHLLDTNQLDANCIPFQEFDINGEHL
• Predicted Species: Mouse (92%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EHF
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  EHF Recombinant Protein Antigen (NBP2-56705PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for EHF Antibody - BSA Free

• Epithelium-specific Ets transcription factor 3
• ESE3 transcription factor
• ESE-3
• ESE3B
• ESE3hEHF
• ESEJepithelium-specific ets factor 3
• ETS domain-containing transcription factor
• ets homologous factor

Background

ETS homologous factor (ETS), also known as ETS domain-containing transcription factor, epithelium-specific ETS transcription factor 3, EHF, ESE3, ESE3B, and ESEJ, is a member of the ETS family. This family is characterized by epithelial-specific expression (ESEs). ETS acts as a transcriptional repressor for a specific subset of ETS/AP-1 responsive genes and a modulator of the nuclear response to mitogen-activated protein kinase signaling cascades. As such, ETS may play a role in epithelial differentiation and carcinogenesis. ETS is also involved in TNFRSF10B/DR5 regulation through the ETS-binding sequences on the TNFRSF10B/DR5 promoter.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: EHF