EHF Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit EHF Antibody - BSA Free (NBP2-56705) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MILEGGGVMNLNPGNNLLHQPPAWTDSYSTCNVSSGFFGGQWHEIHPQYWTKYQVWEWLQHLLDTNQLDANCIPFQEFDINGEHL |
| Predicted Species |
Mouse (92%), Rat (94%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
EHF |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for EHF Antibody - BSA Free
Background
ETS homologous factor (ETS), also known as ETS domain-containing transcription factor, epithelium-specific ETS transcription factor 3, EHF, ESE3, ESE3B, and ESEJ, is a member of the ETS family. This family is characterized by epithelial-specific expression (ESEs). ETS acts as a transcriptional repressor for a specific subset of ETS/AP-1 responsive genes and a modulator of the nuclear response to mitogen-activated protein kinase signaling cascades. As such, ETS may play a role in epithelial differentiation and carcinogenesis. ETS is also involved in TNFRSF10B/DR5 regulation through the ETS-binding sequences on the TNFRSF10B/DR5 promoter.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: ELISA, ICC, WB
Species: Mu
Applications: ICC, IHC, Simple Western, WB
Species: Mu
Applications: ELISA
Publications for EHF Antibody (NBP2-56705) (0)
There are no publications for EHF Antibody (NBP2-56705).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for EHF Antibody (NBP2-56705) (0)
There are no reviews for EHF Antibody (NBP2-56705).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for EHF Antibody (NBP2-56705) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional EHF Products
Research Areas for EHF Antibody (NBP2-56705)
Find related products by research area.
|
Blogs on EHF