PACSIN1 Antibody - BSA Free

Western Blot: PACSIN1 Antibody [NBP2-33756] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10, Lane 2: Human Cerebral Cortex tissue

Immunocytochemistry/Immunofluorescence: PACSIN1 Antibody [NBP2-33756] - Staining of human cell line MCF7 shows localization to nucleus, nucleoli & vesicles. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: PACSIN1 Antibody [NBP2-33756] - Staining of human skeletal muscle shows low expression as expected.

Immunohistochemistry-Paraffin: PACSIN1 Antibody [NBP2-33756] - Staining of human cerebral cortex shows high expression.

Immunohistochemistry-Paraffin: PACSIN1 Antibody [NBP2-33756] - Staining in human cerebral cortex and skeletal muscle tissues using anti-PACSIN1 antibody. Corresponding PACSIN1 RNA-seq data are presented for the same tissues.

• Reactivity: Hu, Mu, Rt
• Applications: WB, Simple Western, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PACSIN1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PACSIN1 Antibody - BSA Free (NBP2-33756) is a polyclonal antibody validated for use in IHC, WB, ICC/IF and Simple Western. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: EKQPKKAEGVALTNATGAVESTSQAGDRGSVSSYDRGQPYATEWSDDESGN
• Predicted Species: Mouse (92%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PACSIN1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Simple Western 1:25
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. See Simple Western Antibody Database for Simple Western validation: Human Cortex lysate as sample; separated by size; antibody dilution of 1:25; observed molecular weight was 65 kDa; matrix was 12-230 kDa; detected by Chemiluminescence.
• Control Peptide:

  PACSIN1 Protein (NBP2-33756PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PACSIN1 Antibody - BSA Free

• KIAA1379SDPI
• protein kinase C and casein kinase substrate in neurons 1
• protein kinase C and casein kinase substrate in neurons protein 1
• syndapin I

Background

PACSINs are a family of cytoplasmic phosphoproteins that play a role in vesicle formation and transport. Highly expressed in brain and to a lesser extent in heart, pancreas and liver.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PACSIN1
• Uniprot:
  • Q9BY11(Human)