Dysferlin Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Dysferlin Antibody [NBP1-84696] - Staining of human cell line RH-30 shows localization to plasma membrane & microtubule organizing center.
Immunohistochemistry-Paraffin: Dysferlin Antibody [NBP1-84696] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Dysferlin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:IVVELYDHDTYGADEFMGRCICQPSLERMPRLAWFPLTRGSQPSGELLASFELIQREKPAIHHIPGFEVQETSRILDESEDTDLPYPPPQREANIYMVPQNIKPALQRTAIEILAWG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DYSF
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Dysferlin Protein (NBP1-84696PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Dysferlin Antibody

  • dysferlin
  • dysferlin, limb girdle muscular dystrophy 2B (autosomal recessive)
  • dystrophy-associated fer-1-like 1
  • FER1L1Dystrophy-associated fer-1-like protein
  • Fer-1-like protein 1
  • FLJ00175
  • FLJ90168
  • LGMD2B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-5029
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB120-7164
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, IHC-Fr, MiAr
H00000825-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-84694
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85630
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85632
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85544
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59744
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP2-55584
Species: Hu
Applications: ICC/IF
NBP1-90300
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00000825-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-46574
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB600-1206
Species: Hu, Mu, Rt, Av, Ch, Fi, Ma, Re
Applications: WB, EM, ICC/IF, IHC, IHC-Fr
NBP2-14868
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87851
Species: Hu
Applications: WB, IHC, IHC-P
H00079026-M01
Species: Hu
Applications: WB, ELISA, IP
NBP1-33737
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1936
Species: Hu
Applications: WB, IP

Publications for Dysferlin Antibody (NBP1-84696) (0)

There are no publications for Dysferlin Antibody (NBP1-84696).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Dysferlin Antibody (NBP1-84696) (0)

There are no reviews for Dysferlin Antibody (NBP1-84696). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Dysferlin Antibody (NBP1-84696) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Dysferlin Products

Bioinformatics Tool for Dysferlin Antibody (NBP1-84696)

Discover related pathways, diseases and genes to Dysferlin Antibody (NBP1-84696). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Dysferlin Antibody (NBP1-84696)

Discover more about diseases related to Dysferlin Antibody (NBP1-84696).
 

Pathways for Dysferlin Antibody (NBP1-84696)

View related products by pathway.

PTMs for Dysferlin Antibody (NBP1-84696)

Learn more about PTMs related to Dysferlin Antibody (NBP1-84696).
 

Research Areas for Dysferlin Antibody (NBP1-84696)

Find related products by research area.

Blogs on Dysferlin

There are no specific blogs for Dysferlin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Dysferlin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DYSF