EHBP1 Antibody

Images

 
Western Blot: EHBP1 Antibody [NBP1-93614] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-178
Immunocytochemistry/ Immunofluorescence: EHBP1 Antibody [NBP1-93614] - Staining of human cell line U-2 OS shows positivity in cytoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: EHBP1 Antibody [NBP1-93614] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: EHBP1 Antibody [NBP1-93614] - Staining of human testis shows strong cytoplasmic positivity in cells of seminiferous ducts.
Orthogonal Strategies: Immunohistochemistry-Paraffin: EHBP1 Antibody [NBP1-93614] - Staining in human testis and skeletal muscle tissues using anti-EHBP1 antibody. Corresponding EHBP1 RNA-seq data are presented ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

EHBP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MRSAKSASSSEELINKLNFLDEAEKDLATVNSNPFDDPDAAELNPFGDPDSEEPITETASPRKTEDSFYNNSYNPFKEVQTPQYLNPFDEPEAFV
Specificity
Specificity of human EHBP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EHBP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Publications
Read Publication using
NBP1-93614 in the following applications:

  • WB
    1 publication

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for EHBP1 Antibody

  • EH domain binding protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-31896
Species: Hu
Applications: WB, IHC, IHC-P
MAB8480
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
NBP1-79481
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB, IHC
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-IC
NBP2-33283
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
NBP1-54873
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb
Applications: WB, IHC, IHC-P
NBP1-87067
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-92310
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP2-31364
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74359
Species: Hu, Mu, Ch
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF7869
Species: Hu
Applications: WB, ICC
NBP1-88323
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46390
Species: Hu
Applications: WB, IHC
H00005013-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, RNAi
NBP1-88969
Species: Hu
Applications: IHC, IHC-P
NB100-56672
Species: Hu, Mu
Applications: WB, IHC-P

Publications for EHBP1 Antibody (NBP1-93614)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for EHBP1 Antibody (NBP1-93614) (0)

There are no reviews for EHBP1 Antibody (NBP1-93614). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for EHBP1 Antibody (NBP1-93614) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EHBP1 Products

Array NBP1-93614

Bioinformatics Tool for EHBP1 Antibody (NBP1-93614)

Discover related pathways, diseases and genes to EHBP1 Antibody (NBP1-93614). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EHBP1 Antibody (NBP1-93614)

Discover more about diseases related to EHBP1 Antibody (NBP1-93614).
 

Pathways for EHBP1 Antibody (NBP1-93614)

View related products by pathway.

PTMs for EHBP1 Antibody (NBP1-93614)

Learn more about PTMs related to EHBP1 Antibody (NBP1-93614).

Blogs on EHBP1

There are no specific blogs for EHBP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EHBP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EHBP1