EHBP1 Antibody

Western Blot: EHBP1 Antibody [NBP1-93614] - EHD2 localizes to the plasma membrane independent of its interaction partners, syndapin2 and EHBP1.HeLa cells were treated with non-targeting control-, syndapin2- or EHBP1-siRNA for 72 h. Cells were then lysed, and equal amounts of proteins were separated by SDS-PAGE and subjected to immunoblotting with antibodies against syndapin2, EHBP1, EHD2, caveolin1 or actin. Image collected and cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pone.0074519), licensed under a CC-BY license.

Immunocytochemistry/Immunofluorescence: EHBP1 Antibody [NBP1-93614] - Staining of human cell line U-2 OS shows positivity in cytoplasm. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: EHBP1 Antibody [NBP1-93614] - Staining of human skeletal muscle shows negative to very weak cytoplasmic positivity in myocytes.

Western Blot: EHBP1 Antibody [NBP1-93614] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-178

Immunohistochemistry-Paraffin: EHBP1 Antibody [NBP1-93614] - Staining of human testis shows strong cytoplasmic positivity in cells of seminiferous ducts.

Immunohistochemistry-Paraffin: EHBP1 Antibody [NBP1-93614] - Staining of human skeletal muscle shows low expression as expected.

Immunohistochemistry-Paraffin: EHBP1 Antibody [NBP1-93614] - Analysis in human testis and skeletal muscle tissues using NBP1-93614 antibody. Corresponding EHBP1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: EHBP1 Antibody [NBP1-93614] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

EHBP1 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MRSAKSASSSEELINKLNFLDEAEKDLATVNSNPFDDPDAAELNPFGDPDSEEPITETASPRKTEDSFYNNSYNPFKEVQTPQYLNPFDEPEAFV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EHBP1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
  • Western Blot 1:100-1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  EHBP1 Protein (NBP1-93614PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for EHBP1 Antibody

• EH domain binding protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for EHBP1 Antibody (NBP1-93614)(1)

Publication using NBP1-93614

• Simone LC, Caplan S, Naslavsky N. Role of Phosphatidylinositol 4,5-Bisphosphate in Regulating EHD2 Plasma Membrane Localization. PLoS One. 2013-09-10 [PMID: 24040268] (WB, Human)

Bioinformatics

• Gene Symbol: EHBP1