EHD4 Antibody

Images

 
Western Blot: EHD4 Antibody [NBP1-54873] - Trafficking proteins levels in hippocampus of 11 months old rats exposed to rotenone (ROT, 1 mg/kg/day) or DMSO (control), during 8 weeks, and exercised during 6 weeks (EXE) or ...read more
Immunohistochemistry: EHD4 Antibody [NBP1-54873] - Human Thyroid lysate tissue at an antibody concentration of 5.0 ug/ml using anti-EHD4 antibody
Western Blot: EHD4 Antibody [NBP1-54873] - Reccomended Titration: 1 ug/ml Positive Control: Fetal Lung cell lysate
Western Blot: EHD4 Antibody [NBP1-54873] - Sample Tissue: Human 786-0 Antibody Dilution: 1.0 ug/ml
Immunohistochemistry: EHD4 Antibody [NBP1-54873] - Staining of human Thyroid.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EHD4 Antibody Summary

Immunogen
Synthetic peptides corresponding to EHD4(EH-domain containing 4) The peptide sequence was selected from the middle region of EHD4. Peptide sequence LMNLISQEETSTPTQLVQGGAFDGTTEGPFNQGYGEGAKEGADEEEWVVA. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EHD4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against EHD4 and was validated on Western blot.
Theoretical MW
61 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using
NBP1-54873 in the following applications:

  • WB
    1 publication

Reactivity Notes

Use in Rat reported in scientific literature (PMID:30135925).

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for EHD4 Antibody

  • EH domain containing 4
  • EH domain-containing protein 4
  • EH-domain containing 4
  • HCA10
  • HCA11
  • Hepatocellular carcinoma-associated protein 10/11
  • hepatocellular carcinoma-associated protein HCA11
  • ortholog of rat pincher
  • PAST homolog 4
  • PAST4

Background

EHD4 is involved in the control of trafficking at the early endosome and regulates exit of cargo toward both the recycling compartment and the late endocytic pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-31896
Species: Hu
Applications: IHC, IHC-Fr, IHC-P, WB
NBP2-56035
Species: Hu
Applications: ICC/IF, KO, WB
MAB8480
Species: Hu
Applications: ICC, ICFlow, Simple Western, WB
NBP2-33283
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF1056
Species: Rt
Applications: IHC, WB
AF2848
Species: Hu, Mu
Applications: ICC, WB
DBD00
Species: Hu
Applications: ELISA
2914-HT
Species: Hu
Applications: BA
H00007170-M02
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
NB500-178
Species: Ch, Hu, Mu
Applications: ICC/IF, Simple Western, WB
688-TK
Species: Hu
Applications: BA
256-GF/CF
Species: Hu
Applications: BA
NBP1-49533
Species: Hu, Mu, Pl, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, WB
NBP2-67165
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-93614
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-56681
Species: Hu, Mu, Rb, Rt, Sh
Applications: ELISA, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-88582
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-54873
Species: Hu, Rt
Applications: WB, IHC, IHC-P

Publications for EHD4 Antibody (NBP1-54873)(1)

We have publications tested in 1 confirmed species: Rat.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Rat
(1)
All Species

Reviews for EHD4 Antibody (NBP1-54873) (0)

There are no reviews for EHD4 Antibody (NBP1-54873). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EHD4 Antibody (NBP1-54873) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EHD4 Products

Bioinformatics Tool for EHD4 Antibody (NBP1-54873)

Discover related pathways, diseases and genes to EHD4 Antibody (NBP1-54873). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EHD4 Antibody (NBP1-54873)

Discover more about diseases related to EHD4 Antibody (NBP1-54873).
 

Pathways for EHD4 Antibody (NBP1-54873)

View related products by pathway.

PTMs for EHD4 Antibody (NBP1-54873)

Learn more about PTMs related to EHD4 Antibody (NBP1-54873).

Blogs on EHD4

There are no specific blogs for EHD4, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EHD4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EHD4
Uniprot