EFEMP2 Antibody - BSA Free

Western Blot: EFEMP2 Antibody [NBP2-87331] - WB Suggested Anti-EFEMP2 Antibody Titration: 0.2-1 ug/ml. Positive Control: NCI-H226 cell lysate

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

EFEMP2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit EFEMP2 Antibody - BSA Free (NBP2-87331) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human EFEMP2. Peptide sequence: VSAMLVLARPVTGPREYVLDLEMVTMNSLMSYRASSVLRLTVFVGAYTF The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EFEMP2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for EFEMP2 Antibody - BSA Free

• EGF containing fibulin-like extracellular matrix protein 2
• EGF-containing fibulin-like extracellular matrix protein 2
• FBLN4fibulin-4
• FIBL-4
• fibulin 4
• Fibulin-4
• MBP1
• Protein UPH1
• UPH1mutant p53 binding protein 1

Background

EFEMP2 is alarge number of extracellular matrix proteins have been found to contain variations of the epidermal growth factor (EGF) domain and have been implicated in functions as diverse as blood coagulation, activation of complement and determination of cell fate during development. The protein encoded by this gene contains four EGF2 domains and six calcium binding EGF2 domains. This gene is necessary for elastic fiber formation and connective tissue development. Defects in this gene are cause of an autosomal recessive cutis laxa syndrome.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: EFEMP2