EDIL3/DEL1 Antibody - Azide and BSA Free

Western Blot: EDIL3/DEL1 Antibody [H00010085-B01P] - Analysis of EDIL3 expression in transfected 293T cell line by EDIL3 polyclonal antibody. Lane 1: EDIL3 transfected lysate(52.8 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

EDIL3/DEL1 Antibody - Azide and BSA Free Summary

• Immunogen: EDIL3 (NP_005702.3, 1 a.a. - 480 a.a.) full-length human protein. MKRSVAVWLLVGLSLGVPQFGKGDICDPNPCENGGICLPGLADGSFSCECPDGFTDPNCSSVVEVASDEEEPTSAGPCTPNPCHNGGTCEISEAYRGDTFIGYVCKCPRGFNGIHCQHNINECEVEPCKNGGICTDLVANYSCECPGEFMGRNCQYKCSGPLGIEGGIISNQQITASSTHRALFGLQKWYPYYARLNKKGLINAWTAAENDRWPWIQINLQRKMRVTGVITQGAKRIGSPEYIKSYKIAYSNDGKTWAMYKVKGTNEDMVFRGNIDNNTPYANSFTPPIKAQYVRLYPQVCRRHCTLRMELLGCELSGCSEPLGMKSGHIQDYQITASSIFRTLNMDMFTWEPRKARLDKQGKVNAWTSGHNDQSQWLQVDLLVPTKVTGIITQGAKDFGHVQFVGSYKLAYSNDGEHWTVYQDEKQRKDKVFQGNFDNDTHRKNVIDPPIYARHIRILPWSWYGRITLRSELLGCTEEE
• Specificity: EDIL3 - EGF-like repeats and discoidin I-like domains 3,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: EDIL3
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot 1:500
• Application Notes: Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for EDIL3/DEL1 Antibody - Azide and BSA Free

• DEL1
• DEL1developmental endothelial locus-1
• Developmentally-regulated endothelial cell locus 1 protein
• EDIL3
• EGF-like repeat and discoidin I-like domain-containing protein 3
• EGF-like repeats and discoidin I-like domains 3
• Integrin-binding protein DEL1
• MGC26287

Background

The protein encoded by this gene is an integrin ligand. It plays an important role in mediating angiogenesis and may be important in vessel wall remodeling and development. It also influences endothelial cell behavior. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for EDIL3/DEL1 Antibody (H00010085-B01P)(2)

Publications using H00010085-B01P

• Nixon B, Mitchell LA, Anderson AL et al. Proteomic and functional analysis of human sperm detergent resistant membranes. J Cell Physiol 2011-10-01 [PMID: 21792924]
• Ebert B, Kisiela M, Wsol V et al. Proteomic and functional analysis of human sperm detergent resistant membranes. Chem Biol Interact 2011-01-06 [PMID: 21190223]

Bioinformatics

• Gene Symbol: EDIL3
• Entrez:
  • 10085(Human)
• Uniprot:
  • NP_005702.3(Human)