EAAT1/GLAST-1/SLC1A3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: EAAT1/GLAST-1/SLC1A3 Antibody [NBP1-84940] - Immunofluorescent staining of human cell line U-251 MG shows localization to mitochondria.
Immunohistochemistry-Paraffin: EAAT1/GLAST-1/SLC1A3 Antibody [NBP1-84940] - Staining of human hippocampus shows distinct positivity in neuropil.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EAAT1/GLAST-1/SLC1A3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NGEEPKMGGRMERFQQGVRKRTLLAKKKVQNITKEDVK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC1A3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
EAAT1/GLAST-1/SLC1A3 Protein (NBP1-84940PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for EAAT1/GLAST-1/SLC1A3 Antibody

  • EA6
  • EA6FLJ25094
  • EAAT1
  • EAAT1GLAST-1
  • excitatory amino acid transporter 1
  • GLAST1
  • GLAST-1
  • GLASTGLAST1
  • SLC1A3
  • Sodium-dependent glutamate/aspartate transporter 1
  • solute carrier family 1 (glial high affinity glutamate transporter), member 3
  • Solute carrier family 1 member 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-59632
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84938
Species: Hu
Applications: IHC, IHC-P
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NBP2-48740
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-13317
Species: Hu
Applications: IHC, IHC-P
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2180
Species: Hu
Applications: WB, Simple Western, IP
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
MAB1259
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
NB300-124
Species: Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP2-27073
Species: Hu, Mu, Bv, Eq, Op, Pm
Applications: WB, IHC-P
NBP2-46627
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
MAB4514
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
NBP1-84940
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for EAAT1/GLAST-1/SLC1A3 Antibody (NBP1-84940) (0)

There are no publications for EAAT1/GLAST-1/SLC1A3 Antibody (NBP1-84940).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EAAT1/GLAST-1/SLC1A3 Antibody (NBP1-84940) (0)

There are no reviews for EAAT1/GLAST-1/SLC1A3 Antibody (NBP1-84940). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for EAAT1/GLAST-1/SLC1A3 Antibody (NBP1-84940) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EAAT1/GLAST-1/SLC1A3 Products

Bioinformatics Tool for EAAT1/GLAST-1/SLC1A3 Antibody (NBP1-84940)

Discover related pathways, diseases and genes to EAAT1/GLAST-1/SLC1A3 Antibody (NBP1-84940). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EAAT1/GLAST-1/SLC1A3 Antibody (NBP1-84940)

Discover more about diseases related to EAAT1/GLAST-1/SLC1A3 Antibody (NBP1-84940).
 

Pathways for EAAT1/GLAST-1/SLC1A3 Antibody (NBP1-84940)

View related products by pathway.

PTMs for EAAT1/GLAST-1/SLC1A3 Antibody (NBP1-84940)

Learn more about PTMs related to EAAT1/GLAST-1/SLC1A3 Antibody (NBP1-84940).
 

Research Areas for EAAT1/GLAST-1/SLC1A3 Antibody (NBP1-84940)

Find related products by research area.

Blogs on EAAT1/GLAST-1/SLC1A3

There are no specific blogs for EAAT1/GLAST-1/SLC1A3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EAAT1/GLAST-1/SLC1A3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC1A3
Entrez