Dystrophin Antibody

Images

 
Immunohistochemistry: Dystrophin Antibody [NBP1-89954] - Staining of human heart muscle shows strong cytoplasmic and membranous positivity in myocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Dystrophin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VVCQQSATQRLEHAFNIARYQLGIEKLLDPEDVDTTYPDKKSILMYITSLFQVLPQQVSIEAIQEVEMLPRPPKVTKEEHFQLHHQMHYSQQITVSLAQGYERTSSPKPRFKSYAYTQAAYVTTSDPTRSPFPSQHLEAPEDKSFGSS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DMD
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Dystrophin Protein (NBP1-89954PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Dystrophin Antibody

  • BMDDXS272
  • CMD3B
  • DXS142
  • DXS164
  • DXS164, DXS206, DXS230, DXS239, DXS268, DXS269, DXS270, DXS272
  • DXS206
  • DXS230
  • DXS239
  • DXS268
  • DXS269
  • DXS270
  • dystrophin (muscular dystrophy, Duchenne and Becker types), includes DXS142
  • dystrophin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
NBP2-35213
Species: Hu
H00007402-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-86713
Species: Hu
Applications: IHC, IHC-P
NB100-56505
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
NBP2-14868
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB110-3638
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NBP1-89134
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-32263
Species: Hu
Applications: WB, IHC, IP
NBP1-89131
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89954
Species: Hu
Applications: IHC, IHC-P

Publications for Dystrophin Antibody (NBP1-89954) (0)

There are no publications for Dystrophin Antibody (NBP1-89954).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Dystrophin Antibody (NBP1-89954) (0)

There are no reviews for Dystrophin Antibody (NBP1-89954). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Dystrophin Antibody (NBP1-89954) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Dystrophin Products

Bioinformatics Tool for Dystrophin Antibody (NBP1-89954)

Discover related pathways, diseases and genes to Dystrophin Antibody (NBP1-89954). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Dystrophin Antibody (NBP1-89954)

Discover more about diseases related to Dystrophin Antibody (NBP1-89954).
 

Pathways for Dystrophin Antibody (NBP1-89954)

View related products by pathway.

PTMs for Dystrophin Antibody (NBP1-89954)

Learn more about PTMs related to Dystrophin Antibody (NBP1-89954).
 

Research Areas for Dystrophin Antibody (NBP1-89954)

Find related products by research area.

Blogs on Dystrophin.

Could Laminin be Used to Treat Duchenne Muscular Dystrophy?
Duchenne muscular dystrophy (DMD) is a severe muscle wasting condition, causing disability and early death. There is currently no cure or adequate treatment for DMD, but pioneering research indicates that injection of a laminin protein may prevent (or...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Dystrophin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DMD