DSCR4 Antibody

Images

 
Western Blot: DSCR4 Antibody [NBP1-84295] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: DSCR4 Antibody [NBP1-84295] - Staining of human pancreas shows strong cytoplasmic positivity in pancreatic duct cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DSCR4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MSLIILTRDDEPRIFTPDSDAASPALHSTSPLPDPASASPLHREEKILPKVCNIVSCLSFSLPASPTDSGLASPTIITREGQQFWAKCLIWKYQLYLHGLHKKSDGR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DSCR4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
DSCR4 Protein (NBP1-84295PEP)
Publications
Read Publication using NBP1-84295.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DSCR4 Antibody

  • DCRBDown syndrome critical region protein B, 10DSCRBDown syndrome critical region protein 4
  • Down syndrome critical region gene 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84294
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-46852
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-86687
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-82648
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84975
Species: Hu
Applications: WB, IHC, IHC-P
AF6116
Species: Hu
Applications: WB, ICC
NB100-74575
Species: Hu
Applications: WB, PEP-ELISA
NBP1-76995
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-60052
Species: Hu
Applications: WB
NBP2-02450
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83091
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84296
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88527
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00253738-M05
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
NB600-501
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, Fi, GP, Ha, Le, Ma, Pm, Rb, Sh, Sq, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB110-58870
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF
NBP1-90187
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84295
Species: Hu
Applications: WB, IHC, IHC-P

Publications for DSCR4 Antibody (NBP1-84295)(1)


Reviews for DSCR4 Antibody (NBP1-84295) (0)

There are no reviews for DSCR4 Antibody (NBP1-84295). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DSCR4 Antibody (NBP1-84295) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DSCR4 Products

Bioinformatics Tool for DSCR4 Antibody (NBP1-84295)

Discover related pathways, diseases and genes to DSCR4 Antibody (NBP1-84295). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DSCR4 Antibody (NBP1-84295)

Discover more about diseases related to DSCR4 Antibody (NBP1-84295).
 

Pathways for DSCR4 Antibody (NBP1-84295)

View related products by pathway.

PTMs for DSCR4 Antibody (NBP1-84295)

Learn more about PTMs related to DSCR4 Antibody (NBP1-84295).

Blogs on DSCR4

There are no specific blogs for DSCR4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DSCR4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DSCR4