EBF-3 Antibody (8D6)

Images

 
Western Blot: EBF-3 Antibody (8D6) [H00253738-M05] - Analysis of EBF3 expression in IMR-32 (Cat # L008V1).
Immunohistochemistry-Paraffin: EBF-3 Antibody (8D6) [H00253738-M05] - Analysis of monoclonal antibody to EBF3 on formalin-fixed paraffin-embedded human lymph node. Antibody concentration 0.3 ug/ml
Western Blot: EBF-3 Antibody (8D6) [H00253738-M05] - Analysis of EBF3 expression in NIH/3T3 (Cat # L018V1).
ELISA: EBF-3 Antibody (8D6) [H00253738-M05] - Detection limit for recombinant GST tagged EBF3 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Clone
8D6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

EBF-3 Antibody (8D6) Summary

Immunogen
EBF3 (NP_001005463, 381 a.a. ~ 480 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LYGMPHNNQEIILKRAADIAEALYSVPRNHNQIPTLGNNPAHTGMMGVNSFSSQLAVNVSETSQANDQVGYSRNTSSVSPRGYVPSSTPQQSNYNTVSTS
Specificity
EBF3 (8D6)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
EBF3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Frozen
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for ELISA and immunohistochemistry (paraffin).
Publications
Read Publications using
H00253738-M05 in the following applications:

  • IHC
    2 publications

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 29180763).

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for EBF-3 Antibody (8D6)

  • COE3
  • COE3OE-2
  • DKFZp667B0210
  • early B-cell factor 3O/E-2
  • EBF3
  • EBF-3
  • OE-2
  • Olf-1/EBF-like 2
  • transcription factor COE3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5165
Species: Hu, Mu
Applications: WB
NBP2-75477
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-00714
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-83090
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-28711
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
AF7006
Species: Hu, Mu
Applications: IHC, WB
MAB8398
Species: Hu
Applications: CyTOF-ready, Flow
NBP2-29463
Species: Pm, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF1555
Species: Hu
Applications: WB
NBP1-84928
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-17099
Species: Hu
Applications: IHC, IHC-P
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-46085
Species: Hu
Applications: IHC, WB
NB100-1780
Species: Hu, Mu
Applications: Flow, PEP-ELISA, WB
NBP2-03688
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF7068
Species: Hu
Applications: ICC, IHC, WB
NBP2-92535
Species: Hu, Mu, Rt
Applications: WB

Publications for EBF-3 Antibody (H00253738-M05)(4)

Reviews for EBF-3 Antibody (H00253738-M05) (0)

There are no reviews for EBF-3 Antibody (H00253738-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for EBF-3 Antibody (H00253738-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EBF-3 Products

Bioinformatics Tool for EBF-3 Antibody (H00253738-M05)

Discover related pathways, diseases and genes to EBF-3 Antibody (H00253738-M05). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EBF-3 Antibody (H00253738-M05)

Discover more about diseases related to EBF-3 Antibody (H00253738-M05).
 

Pathways for EBF-3 Antibody (H00253738-M05)

View related products by pathway.

PTMs for EBF-3 Antibody (H00253738-M05)

Learn more about PTMs related to EBF-3 Antibody (H00253738-M05).

Blogs on EBF-3

There are no specific blogs for EBF-3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EBF-3 Antibody (8D6) and receive a gift card or discount.

Bioinformatics

Gene Symbol EBF3
Entrez
OMIM
Uniprot