DSCR3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: DSCR3 Antibody [NBP1-84296] - Immunofluorescent staining of human cell line U-251 MG shows localization to mitochondria.
Immunohistochemistry-Paraffin: DSCR3 Antibody [NBP1-84296] - Staining of human rectum shows strong cytoplasmic positivity in granular pattern in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DSCR3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GKFPSGKTEIPFEFPLHLKGNKVLYETYHGVFVNIQYTLRCDMKRSLLAKDLTKTCEFIVHSAPQKGKFTPSPV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DSCR3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DSCR3 Protein (NBP1-84296PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DSCR3 Antibody

  • DCRA10Down syndrome critical region protein 3
  • Down syndrome critical region gene 3
  • DSCRA
  • MGC117385

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
NBP2-36754
Species: Hu
Applications: WB, IB, ICC/IF, IHC
NBP1-46852
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-84293
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1903
Species: Hu, Mu, Rt, Po, Ca, Ha, Pm
Applications: WB, B/N, Flow, ICC/IF, IHC-P, IP
H00001859-M01
Species: Hu
Applications: WB, ELISA, IHC, IP
MAB38461
Species: Hu
Applications: WB, IHC
NB120-2941
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
H00009768-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-84294
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86687
Species: Hu
Applications: WB, IHC, IHC-P
H00058516-B02P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-58006
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-58068
Species: Hu
Applications: ICC/IF, IHC-P
NB100-1397
Species: Hu, Mu, Rt, ChHa
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA, ICC
NBP2-45825
Species: Hu
Applications: WB, IHC
NBP1-84975
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84296
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for DSCR3 Antibody (NBP1-84296) (0)

There are no publications for DSCR3 Antibody (NBP1-84296).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DSCR3 Antibody (NBP1-84296) (0)

There are no reviews for DSCR3 Antibody (NBP1-84296). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for DSCR3 Antibody (NBP1-84296) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DSCR3 Products

Bioinformatics Tool for DSCR3 Antibody (NBP1-84296)

Discover related pathways, diseases and genes to DSCR3 Antibody (NBP1-84296). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DSCR3 Antibody (NBP1-84296)

Discover more about diseases related to DSCR3 Antibody (NBP1-84296).
 

Pathways for DSCR3 Antibody (NBP1-84296)

View related products by pathway.

Blogs on DSCR3

There are no specific blogs for DSCR3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DSCR3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DSCR3