DRG2 Antibody - BSA Free

Western Blot: DRG2 Antibody [NBP2-84821] - Host: Rabbit. Target Name: DRG2. Sample Type: Fetal Kidney lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

DRG2 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human DRG2. Peptide sequence: MGILEKISEIEKEIARTQKNKATEYHLGLLKAKLAKYRAQLLEPSKSASS The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DRG2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for DRG2 Antibody - BSA Free

• developmentally regulated GTP binding protein 2
• developmentally regulated GTP-binding protein 2
• developmentally-regulated GTP-binding protein 2
• DRG-2

Background

The DRG2 gene encodes the developmentally regulated GTP-binding protein 2, a name derived from the fact that it sharessignificant similarity to known GTP-binding proteins. DRG2 was identified because it is expressed in normalfibroblasts but not in SV40-transformed fibroblasts. Read-through transcripts containing this gene and a downstreamgene have been identified, but they are not thought to encode a fusion protein. This gene is located within theSmith-Magenis syndrome region on chromosome 17. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DRG2