DPPA2 Antibody - BSA Free

Western Blot: DPPA2 Antibody [NBP1-85426] - Analysis in control (vector only transfected HEK293T lysate) and DPPA2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunocytochemistry/Immunofluorescence: DPPA2 Antibody [NBP1-85426] - Staining of human cell line U-2 OS shows localization to nucleus. Antibody staining is shown in green.

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DPPA2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DWCQQLGLSTNGKKIEVYLRLHRHAYPEQRQDMPEMSQETRLQRCSRKRKAVTKRARLQRSYEMNERAEETNTVEVITSAPG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DPPA2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  DPPA2 Protein (NBP1-85426PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for DPPA2 Antibody - BSA Free

• CT100
• developmental pluripotency associated 2
• developmental pluripotency-associated protein 2
• DPPA2
• ECSA
• PESCRG1
• PESCRG1cancer/testis antigen 100
• Pluripotent embryonic stem cell-related gene 1 protein

Background

DPPA2, also known as Developmental pluripotency-associated protein 2, is a 33.8 kDa, 298 amino acid protein that is involved in binding to target gene promoters, such as SYCE1 and NKX2-5. Diseases such as epithelial ovarian cancer and lung cancer have been researched with this protein. The protein interacts with other proteins such as DPPA4, FXR2, MCM10, DVL2, and AP2M1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DPPA2