DPEP3 Antibody

Images

 
Immunohistochemistry-Paraffin: DPEP3 Antibody [NBP2-32395] - Staining of human testis shows strong cytoplasmic and membranous positivity in cells in seminiferus ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DPEP3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: KVREESRAQSPVEAEFPYGQLSTSCHSHLVPQNGHQATHLEVTKQPTNRV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DPEP3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
DPEP3 Protein (NBP2-32395PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DPEP3 Antibody

  • Dipeptidase 3
  • EC 3.4.13.19
  • MBD3
  • Membrane-Bound Dipeptidase 3
  • Metallopeptidase (Family M19)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56326
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-81657
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-86304
Species: Hu
Applications: IHC, IHC-P
NB100-56537
Species: Hu, Mu
Applications: WB, ChIP, IP
NBP1-86087
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NBP2-24393
Species: Hu
Applications: WB
NB100-56519
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, IHC-FrFl
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NBP1-41201
Species: Hu
Applications: WB, ChIP, ICC/IF, IHC, IP
NBP1-87109
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03993
Species: Hu, Bv, Ca, Pm
Applications: WB, IHC, IHC-P
NB120-3535
Species: Hu, Mu, Fi
Applications: WB, ICC/IF, IHC
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-260
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB100-56483
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56924
Species: Hu
Applications: ICC/IF
NBP2-32395
Species: Hu
Applications: IHC, IHC-P

Publications for DPEP3 Antibody (NBP2-32395) (0)

There are no publications for DPEP3 Antibody (NBP2-32395).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DPEP3 Antibody (NBP2-32395) (0)

There are no reviews for DPEP3 Antibody (NBP2-32395). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for DPEP3 Antibody (NBP2-32395) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DPEP3 Products

DPEP3 NBP2-32395

Bioinformatics Tool for DPEP3 Antibody (NBP2-32395)

Discover related pathways, diseases and genes to DPEP3 Antibody (NBP2-32395). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DPEP3 Antibody (NBP2-32395)

Discover more about diseases related to DPEP3 Antibody (NBP2-32395).
 

Pathways for DPEP3 Antibody (NBP2-32395)

View related products by pathway.

PTMs for DPEP3 Antibody (NBP2-32395)

Learn more about PTMs related to DPEP3 Antibody (NBP2-32395).

Blogs on DPEP3

There are no specific blogs for DPEP3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DPEP3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DPEP3