DOCK11 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: DOCK11 Antibody [NBP2-32488] - Staining of human cell line RH-30 shows localization to nucleoli & nuclear membrane. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: DOCK11 Antibody [NBP2-32488] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: DOCK11 Antibody [NBP2-32488] - Staining of human testis shows moderate nuclear and cytoplasmic positivity in cells in seminiferus ducts.

Immunohistochemistry-Paraffin: DOCK11 Antibody [NBP2-32488] - Staining of human kidney shows moderate positivity in nuclear membrane in cells in tubules.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DOCK11 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: KDTVETAQDDETSSQGKAENIMASLERSMHPELMKYGRETEQLNKLSRGDGRQNLFSFDSEVQRLDFSGIEPDIKPFEEKCNKRFLVNCHDLTF
• Predicted Species: Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DOCK11
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  DOCK11 Protein (NBP2-32488PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for DOCK11 Antibody - BSA Free

• ACG
• Activated Cdc42-associated guanine nucleotide exchange factor
• Activated Cdc42-associated guanine nucleotide exchange factor, ACG
• bB128O4.1
• bB128O4.1.1 (novel protein)
• dedicator of cytokinesis 11
• FLJ32122
• FLJ43653
• ZIZ2dedicator of cytokinesis protein 11
• zizimin2
• zizimin-2

Background

DOCK11 (dedicator of cytokinesis 11) is also known as zizimin-2. It is a DOCK180-related guanine nucleotide exchange factor (GEF) for the small GTPase, Cdc42. As a GEF, DOCK11 functions to catalyze the dissociation of GDP from the GTPase. Dissociation of GDP allows an exchange for GTP and subsequent downstream signaling by the GTPase. Alternate names for DOCK11 include activated Cdc42-associated guanine nucleotide exchange factor, ACG, and ZIZ2.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DOCK11