DOCK11 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: DOCK11 Antibody [NBP2-32488] - Immunofluorescent staining of human cell line RH-30 shows localization to nucleoli & nuclear membrane.
Immunohistochemistry-Paraffin: DOCK11 Antibody [NBP2-32488] - Staining of human testis shows moderate nuclear and cytoplasmic positivity in cells in seminiferus ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DOCK11 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: KDTVETAQDDETSSQGKAENIMASLERSMHPELMKYGRETEQLNKLSRGDGRQNLFSFDSEVQRLDFSGIEPDIKPFEEKCNKRFLVNCHDLTF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DOCK11
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DOCK11 Protein (NBP2-32488PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DOCK11 Antibody

  • ACG
  • Activated Cdc42-associated guanine nucleotide exchange factor
  • Activated Cdc42-associated guanine nucleotide exchange factor, ACG
  • bB128O4.1
  • bB128O4.1.1 (novel protein)
  • dedicator of cytokinesis 11
  • FLJ32122
  • FLJ43653
  • ZIZ2dedicator of cytokinesis protein 11
  • zizimin2
  • zizimin-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82787
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF6898
Species: Hu, Mu, Rt
Applications: WB
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
AF482
Species: Mu
Applications: WB, IHC
NBP2-45897
Species: Hu
Applications: WB, IHC
AF6260
Species: Hu
Applications: WB
NBP1-52556
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-13955
Species: Hu
Applications: IHC, IHC-P
NBP2-14907
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-48990
Species: Hu
Applications: ICC/IF, IHC
NBP1-89785
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-37384
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P
AF2007
Species: Hu
Applications: WB
46420002
Species: Hu
Applications: WB, ELISA
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-32488
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for DOCK11 Antibody (NBP2-32488) (0)

There are no publications for DOCK11 Antibody (NBP2-32488).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DOCK11 Antibody (NBP2-32488) (0)

There are no reviews for DOCK11 Antibody (NBP2-32488). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for DOCK11 Antibody (NBP2-32488) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DOCK11 Products

Bioinformatics Tool for DOCK11 Antibody (NBP2-32488)

Discover related pathways, diseases and genes to DOCK11 Antibody (NBP2-32488). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DOCK11 Antibody (NBP2-32488)

Discover more about diseases related to DOCK11 Antibody (NBP2-32488).
 

Pathways for DOCK11 Antibody (NBP2-32488)

View related products by pathway.

Blogs on DOCK11

There are no specific blogs for DOCK11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DOCK11 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DOCK11