DNase II Antibody

Images

 
Immunohistochemistry-Paraffin: DNase II Antibody [NBP2-39068] - Staining of human thyroid gland shows high expression.
Immunohistochemistry: DNase II Antibody [NBP2-39068] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: DNase II Antibody [NBP2-39068] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: DNase II Antibody [NBP2-39068] - Staining in human thyroid gland and skeletal muscle tissues using anti-DNASE2 antibody. Corresponding DNASE2 RNA-seq data are presented for the same ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DNase II Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: NCSDIWQVLNVNQIAFPGPAGPSFNSTEDHSKWCVSPKGPWTCVGDMNRNQGEEQRGGGTLCAQLPALWKAFQPLVKNYQPCNGMARKPSR
Specificity
Specificity of human DNase II antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DNASE2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
DNase II Protein (NBP2-39068PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DNase II Antibody

  • Acid DNase
  • Deoxyribonuclease II alpha
  • deoxyribonuclease II, lysosomal
  • deoxyribonuclease-2-alpha
  • DNase II alpha
  • DNase II, lysosomal
  • DNASE2A
  • DNL
  • DNL2
  • EC 3.1.22.1
  • Lysosomal DNase II
  • R31240_2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
6144-GH
Species: Hu
NBP1-77009
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-84999
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-03828
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP2-22128
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NBP1-89463
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84311
Species: Hu
Applications: IHC, IHC-P
NBP1-26393
Species: Hu
Applications: WB, ICC/IF
AF1029
Species: Mu
Applications: WB, IHC, IP
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Fe, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF6898
Species: Hu, Mu, Rt
Applications: WB
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-2564
Species: Hu
Applications: WB
NBP2-39068
Species: Hu
Applications: IHC, IHC-P

Publications for DNase II Antibody (NBP2-39068) (0)

There are no publications for DNase II Antibody (NBP2-39068).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DNase II Antibody (NBP2-39068) (0)

There are no reviews for DNase II Antibody (NBP2-39068). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for DNase II Antibody (NBP2-39068) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for DNase II Antibody (NBP2-39068)

Discover related pathways, diseases and genes to DNase II Antibody (NBP2-39068). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DNase II Antibody (NBP2-39068)

Discover more about diseases related to DNase II Antibody (NBP2-39068).
 

Pathways for DNase II Antibody (NBP2-39068)

View related products by pathway.

PTMs for DNase II Antibody (NBP2-39068)

Learn more about PTMs related to DNase II Antibody (NBP2-39068).
 

Research Areas for DNase II Antibody (NBP2-39068)

Find related products by research area.

Blogs on DNase II

There are no specific blogs for DNase II, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DNase II Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DNASE2
Uniprot