DNase II Antibody - BSA Free

Immunohistochemistry-Paraffin: DNase II Antibody [NBP2-39068] - Staining of human thyroid gland shows high expression.

Immunohistochemistry: DNase II Antibody [NBP2-39068] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.

Immunohistochemistry-Paraffin: DNase II Antibody [NBP2-39068] - Staining of human skeletal muscle shows low expression as expected.

Immunohistochemistry-Paraffin: DNase II Antibody [NBP2-39068] - Staining in human thyroid gland and skeletal muscle tissues using anti-DNASE2 antibody. Corresponding DNASE2 RNA-seq data are presented for the same tissues.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

DNase II Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit DNase II Antibody - BSA Free (NBP2-39068) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: NCSDIWQVLNVNQIAFPGPAGPSFNSTEDHSKWCVSPKGPWTCVGDMNRNQGEEQRGGGTLCAQLPALWKAFQPLVKNYQPCNGMARKPSR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DNASE2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  DNase II Protein (NBP2-39068PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for DNase II Antibody - BSA Free

• Acid DNase
• Deoxyribonuclease II alpha
• deoxyribonuclease II, lysosomal
• deoxyribonuclease-2-alpha
• DNase II alpha
• DNase II, lysosomal
• DNASE2A
• DNL
• DNL2
• EC 3.1.22.1
• Lysosomal DNase II
• R31240_2

Background

DNase II (EC 3.1.22.1), or 'acid DNase,' hydrolyzes DNA under acidic conditions and is one of 2 distinct mammalian DNases..

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DNASE2
• Uniprot:
  • O00115(Human)