SERPINB1 Antibody

Images

 
Independent Antibodies: Western Blot: SERPINB1 Antibody [NBP1-89072] - Analysis using Anti-SERPINB1 antibody NBP1-89072 (A) shows similar pattern to independent antibody NBP2-49056 (B).
Immunohistochemistry-Paraffin: SERPINB1 Antibody [NBP1-89072] - Staining of human kidney.
Orthogonal Strategies: Western Blot: SERPINB1 Antibody [NBP1-89072] - Analysis in human cell lines SK-MEL-30 and U-251MG using anti-SERPINB1 antibody. Corresponding SERPINB1 RNA-seq data are presented for the ...read more
Immunohistochemistry-Paraffin: SERPINB1 Antibody [NBP1-89072] - Staining of human spleen shows moderate cytoplasmic positivity in cells in red pulp.
Immunohistochemistry-Paraffin: SERPINB1 Antibody [NBP1-89072] - Staining of human cerebral cortex shows low expression as expected.
Immunohistochemistry-Paraffin: SERPINB1 Antibody [NBP1-89072] - Staining of human esophagus shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: SERPINB1 Antibody [NBP1-89072] - Staining in human esophagus and cerebral cortex tissues using anti-SERPINB1 antibody. Corresponding SERPINB1 RNA-seq data are ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: SERPINB1 Antibody [NBP1-89072] - Staining of human bone marrow, kidney, liver and testis using Anti-SERPINB1 antibody NBP1-89072 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: SERPINB1 Antibody [NBP1-89072] - Staining of human bone marrow.
Immunohistochemistry-Paraffin: SERPINB1 Antibody [NBP1-89072] - Staining of human liver.
Immunohistochemistry-Paraffin: SERPINB1 Antibody [NBP1-89072] - Staining of human testis.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SERPINB1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GNWKDKFMKEATTNAPFRLNKKDRKTVKMMYQKKKFAYGYIEDLKCRVLELPYQGEELSMVILLPDDIEDESTGLKKIEEQLTLEKLHEWTKPENLDFIEVNVSLPRFK
Specificity
Specificity of human SERPINB1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SERPINB1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
Application Notes
IHC reported in scientific literature (PMID: 24252366). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control
SERPINB1 Knockout HeLa Cell Lysate
Control Peptide
SERPINB1 Protein (NBP1-89072PEP)
Publications
Read Publication using
NBP1-89072 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 24252366).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SERPINB1 Antibody

  • EILEI
  • ELANH2MNEI
  • elastase
  • leukocyte elastase inhibitor
  • Monocyte/neutrophil elastase inhibitor
  • Peptidase inhibitor 2
  • PI-2
  • PI2M/NEI
  • protease inhibitor 2 (elastase), monocyte/neutrophil derived
  • serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 1
  • Serpin B1
  • serpin peptidase inhibitor, clade B (ovalbumin), member 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP1-32975
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01650
Species: Hu, Mu, Pm
Applications: WB, Flow, IHC, IHC-P
NBP2-33498
Species: Hu
Applications: IHC, IHC-P
NBP1-90309
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33188
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-92172
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-93879
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-33950
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB3428
Species: Hu
Applications: WB, IHC
NB600-922
Species: Ch, V-Vi
Applications: WB, ELISA, IHC, IHC-P, IP
NBP1-89781
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-69571
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB600-930
Species: Hu, Rt
Applications: WB, ELISA
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-92677
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD

Publications for SERPINB1 Antibody (NBP1-89072)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for SERPINB1 Antibody (NBP1-89072) (0)

There are no reviews for SERPINB1 Antibody (NBP1-89072). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SERPINB1 Antibody (NBP1-89072) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SERPINB1 Products

Bioinformatics Tool for SERPINB1 Antibody (NBP1-89072)

Discover related pathways, diseases and genes to SERPINB1 Antibody (NBP1-89072). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SERPINB1 Antibody (NBP1-89072)

Discover more about diseases related to SERPINB1 Antibody (NBP1-89072).
 

Pathways for SERPINB1 Antibody (NBP1-89072)

View related products by pathway.

PTMs for SERPINB1 Antibody (NBP1-89072)

Learn more about PTMs related to SERPINB1 Antibody (NBP1-89072).

Blogs on SERPINB1

There are no specific blogs for SERPINB1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SERPINB1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SERPINB1