DNAJC17 Antibody

Images

 
Western Blot: DNAJC17 Antibody [NBP1-84614] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: DNAJC17 Antibody [NBP1-84614] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: DNAJC17 Antibody [NBP1-84614] - Staining of human stomach, upper shows moderate cytoplasmic and nuclear positivity in glandular cells.
Western Blot: DNAJC17 Antibody [NBP1-84614] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DNAJC17 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:AVVEFATVKAAELAVQNEVGLVDNPLKISWLEGQPQDAVGRSHSGLSKGSVLSERDYESLVMMRMRQAAERQQLIARMQQEDQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DNAJC17
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DNAJC17 Protein (NBP1-84614PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DNAJC17 Antibody

  • DnaJ (Hsp40) homolog, subfamily C, member 17
  • dnaJ homolog subfamily C member 17
  • FLJ10634

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-28487
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, IF
NBP2-19928
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-32610
Species: Hu
Applications: IHC, IHC-P
NB100-56745
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IP
NBP2-03433
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-19854
Species: Hu
Applications: WB, IHC, IHC-P
H00008681-M01
Species: Hu
Applications: WB, ELISA
NBP2-22298
Species: Hu, Mu
Applications: IP (-), WB, IHC-P
NB500-317
Species: Hu, Bv(-), Ca(-), Ch(-), Mu(-), Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, RIA
NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
NBP2-31673
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-77372
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-00129
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
MAB4184
Species: Hu, Mu
Applications: WB, IP, ICC
H00007690-B01P
Species: Hu, Rt
Applications: WB, ICC/IF
NB100-1888
Species: Hu, Mu, Rt
Applications: WB, IHC, PEP-ELISA

Publications for DNAJC17 Antibody (NBP1-84614) (0)

There are no publications for DNAJC17 Antibody (NBP1-84614).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DNAJC17 Antibody (NBP1-84614) (0)

There are no reviews for DNAJC17 Antibody (NBP1-84614). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DNAJC17 Antibody (NBP1-84614) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DNAJC17 Products

Bioinformatics Tool for DNAJC17 Antibody (NBP1-84614)

Discover related pathways, diseases and genes to DNAJC17 Antibody (NBP1-84614). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DNAJC17 Antibody (NBP1-84614)

Discover more about diseases related to DNAJC17 Antibody (NBP1-84614).

Blogs on DNAJC17

There are no specific blogs for DNAJC17, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DNAJC17 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DNAJC17