ZNF131 Antibody (5F1)

Images

 
Immunocytochemistry/ Immunofluorescence: ZNF131 Antibody (5F1) [H00007690-M07] - Analysis of monoclonal antibody to ZNF131 on HeLa cell. Antibody concentration 10 ug/ml
Sandwich ELISA: ZNF131 Antibody (5F1) [H00007690-M07] - Detection limit for recombinant GST tagged ZNF131 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
5F1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ZNF131 Antibody (5F1) Summary

Immunogen
ZNF131 (AAH35875, 139 a.a. - 238 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TSKYRQGDRKGQIKEDGCPSDPTSKQEHMKSHSTESFKCEICNKRYLRESAWKQHLNCYHLEEGGVSKKQRTGKKIHVCQYCEKQFDHFGHFKEHLRKHT
Specificity
ZNF131 (5F1)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ZNF131
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Publications
Read Publication using H00007690-M07.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ZNF131 Antibody (5F1)

  • pHZ-10
  • zinc finger protein 131 (clone pHZ-10)
  • zinc finger protein 131

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90813
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87865
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-28487
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-52432
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC
NBP1-85383
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55823
Species: Hu
Applications: WB, ICC/IF
MAB4184
Species: Hu, Mu
Applications: WB, IP, ICC
NB100-74512
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-97773
Species: Hu
Applications: WB, PEP-ELISA
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22298
Species: Hu, Mu
Applications: IP (-), WB, IHC-P
NBP2-24571
Species: Hu, Mu
Applications: WB, Simple Western, IHC-P
NB120-3515
Species: Hu, Rt, Po, Bv, Ca, Fi, Rb
Applications: WB, IHC, IHC-Fr, IHC-P, ICC
NB500-317
Species: Hu, Bv(-), Ca(-), Ch(-), Mu(-), Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, RIA
H00007690-M07
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for ZNF131 Antibody (H00007690-M07)(1)

Reviews for ZNF131 Antibody (H00007690-M07) (0)

There are no reviews for ZNF131 Antibody (H00007690-M07). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ZNF131 Antibody (H00007690-M07) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZNF131 Products

Bioinformatics Tool for ZNF131 Antibody (H00007690-M07)

Discover related pathways, diseases and genes to ZNF131 Antibody (H00007690-M07). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZNF131 Antibody (H00007690-M07)

Discover more about diseases related to ZNF131 Antibody (H00007690-M07).
 

Pathways for ZNF131 Antibody (H00007690-M07)

View related products by pathway.

PTMs for ZNF131 Antibody (H00007690-M07)

Learn more about PTMs related to ZNF131 Antibody (H00007690-M07).

Blogs on ZNF131

There are no specific blogs for ZNF131, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF131 Antibody (5F1) and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF131
Entrez
OMIM
Uniprot